American_Mer-ps_and_SailorsINI[BOOKMOBI  P!'.)5=gFHOS X> a j t }ZujQ<A * )!2";#D$N%W&`:'i3(r5){E*+,:-:.>/01ú23ռ456 789 :;<&=0)>9?B@LuAUB^CgDqEzFGHIJKL M9NzOժPޕQRST?U IViW=X&Y/Z8p[A\I]R^[M_d(`m9avobc!dJefg2hisjOk)lmnopqqrGst!u*yv3w= xFNyO#zXG{am|j}sS~|TQm/ee,r )3<b>h?z?œ@ A<A,BBBB X|MOBIep# PEXTH|dAbbott, Willis,6 @ c dAmerican Merchant Ships and Sailors߂܁1>TherojectubergBook,mericanerchanthipsndailors,yillis.bbot,llustratedRayrown?/3069 >DŽăWr145 >߅څ*354 > 866 >BOOKSYILLISBBOT/470Paceo663ListqionǓ15600'O?00244ggg_532HAPTER.11768xv18522xIw2437 fVwe309413ׁo߁o80961?VGWG4595Ǟס50892WW8688X7Ǥ66155 oO?@722ȣHranscri'sote'. hЩ forus*anyone9wh@too!with0mreic"hatsoever.ou copygiveHwЃre-undemsQLinclud@jtwPonlit h`="http://www.g}.net">ky ςςɃAuthor:oǂReleaDpril 18, 2ے #48]_''''">Langu0:ngh_'_">Charac@etncoding:SO-8859-1w????">***STARTFHEROJECTUTENBERGźyMERICAN @NTHIPSNDAILORSX_'_"> ϖh3E-text (par Jasonsbell,mmy,
ǧgϜDȪhdAofP)eam#()pgdp)3//2By܀2߆JNavalȒporXsUniStH0i>,YBluejacket1898etc.77o>oi ;ُOǎ3smbl(ћ ! Newhrk՝bDodd,8ad &om_caxtظswnHyH$/f4gc19024OoohSYILLISzBBOTgg'4$?*OJ Navalistoryfhenitedtates(r> '' Blueackets1898ׁattlefield'61__andampfir??_Vic `ablexdiv0eight="2em"
p/+Inarliereriebooksphr(roldhchievemX–ـh77s Hy,romdarPaulon(toat!DewehSchlAAS@son.t؎ordmcans킐wellgawithhideornar defense ofZ,Qun,-QjRasischarghutylothimheerfullgantYefficiPly.IGOO But!re triumphbeo yaXxdreP`hthofq,@ngebraved,oagd[bڍbw0aloriouewpQSSiago,Fult`Es؎fHnclprosworP҆B@[ero#h3.Ԕ ilifbwhooow8yXshipsɕX1constP\#2halcauice-pє8dPHblockadcrui;icapta84oceXline@guidcroؙdfoglossXcraft@(:twhumves,2m8wloadpibili~admirfleetG߰OOOLimQag(shhpolॢspyvxepsupra cnic+courklQdaroftnolf-sacriȔϔuBeӫn0ex8 marȃatigeAadvaqc}o ⢂in8!yerdephoW￟___"Hspan>WILLISOHNBBOTXʺnnrbo`Mich.81, 1902.#'="2F`tispiece234 <(A "PinkSfac 373348?GAavoriteԄkAFleeSla0tohrows礗禿985539DealershoamenomselippedǧǧNjOOOg0202707ggg\peBP Arou8his c7771349S103n>B"mYChahCablϳϵA711OSenKMFly;4Airo0559712Ǻ?uddenMǙHowl4'Starll!罗oooo%604913/RotouldpWG8205140''''MsPBlowsw''''288024///׭yakt1yJawϿ!9146NeareynѬAQuarterdݭrgokKilledrעǼ32469s16Oris`ShipJ@ey׾׻ׄa,6߻߻߻IyetredȫЗZp2WWWWWWW0354c7____XIinkeavy????T79GGGGt;StrivYReach IDhtdPo_ﺗ7065t8wȿxyellownbDi(*WalkedϺϽOϿwx93379oԔcouaya'''''(400520"2''''חCau!9Icackߴߴ߿032894AdriftFloeǾǾǾlj-745׾ǾǾǫDeLong'senraggheiroatsﬨ___1311lign="left">Anrcticouse 2247σEsquimau79977wsTheoodenateauxfFurraders'''>facing 36656036"qRed-MxSetponimndlewtll7617541Onefirstakeailo///?8039<3///G@wooat-LoadscsrdedsTookaPrison`Ǘ99825|anishyp(ϛ871949Whaleback950715ߠϣFlatb"MannwithiflemenGGG'''0519884 6'ל'$EvenwouldassnudeJHarmleJollitygWWWWH2974T7gWWissppiМ(tOOOOD5837D8gOODeck iCottoGGG=663490GGGDeedq,nac////%72H//>Bank߹߹߹60972+31߹߹߽Boyrk0irƢyutt)ofT觇7777Y246 32277774dfromBRT364588rawlaory/D4612337774StriSchohearsHrough耸L@Knif//ߧߧ߾509433Minot'sedgཹ7037WhistBuow߼߼ߚ8620d5߼߼߼Re8ueerggggt9Ȟt6gggdLaunc*a@feSurfǼǼǼǼ704716ǼǼDzwxciMo`tqʐd/Y959]hablediv0)="2emp
h2cer">Co@nth2HAPTER.1<3fontize="-1">1
CHAPTERI.7>AngFhoafalavdePomPhlaybymxNewng(dawpi1AuspicHWhichurrd fG-gSabbath-BkCondڭ 6z*QVesselCaptPpPhedtMutin,xnv,BMur/eZAbolSoPtyrpnwfultribPoeadWaDi18yncqYLawolSh`_dEvir8509389V@Indr9KDopⶠ Knowo AnruSho0%Beginnȕ>Deep-sh>r,1e ϼGR KlAlSXҶEx̂sAnxlexypO/ecNalHqmbargo'Yoag`fe''''!243822"121///////.vح?:T(n1SailoBuildu+)SystemDuH )Metho"DiһpjofiNPicsqufCalGle%(polaryrmP8lbO￈Oldʷ@eishiuExt1h;eOЪnدHitػDsamэ/Chaur,NeufcháteloMamh׿Uѹ@voysǞRusǡб ls'atߠ̍er@Ho,tya=SummyLWorkϲ309279S55WIticgedՑΝFrozo irohnPankRons#eekeNorthooemonSRsdxpp 8acic0aroyPr.aiHayrƀll,urirlYEscapHiȦ𼽽Ill-FdJeannetteHediaash;SufferingndeathfHLoHisompanions—AitifuliaryThereelyxpedonIt8arePlanlete0sasterRescueItSurvivor%Pe,ellman, Baldwin<3fontize="-1">193 align="cen0">CHAPTERII.?>_P ττɄjify">Newng:X񕦬Qemۗ*!!ury*bzAb;8vigst0msroughڼȫ)-er'dze;soilqobdtCcultivatoeft`zدhnolik{SHhдdra0ag0@jc.͆osɷs)o"chap\@ryƍqаDigaѾcod-fisPyșursua搸Cap8nS9b(wIhau2be9growjcarcitypPӅڥȔsgðػ2bankvalu¤:irta8ѶPgt YihɈ-CodS1y@gntga!8pб` L.ƶ)nihoouhthisherogressasasyooastingoyages,ndoEuropePAsia.P 4 ππThere Psomenflictf toriansverZti(Iplace1 beginniship-buildinmerica. Xirstpel)whicheaveecordB"Viria,{ ttmouthEKennebeci1608,zarry!aisHtednglishlonyStIsl.ӏawo-m`308burdennextn5PDutyachṫ{On`tolNework15.owadayailorsefin Tth!ieszgoPtoodchampagne,Œno,Aypeg16enRsmallx8i scription.ꓔformcialurposX)Yi BlBayat yittleloop 6.aturely9 g8peRifٚآv0,swbyohninthHotsmMkednZFourJuly,31—aafAlapsZohundrhHty-f)yeamemuЩworld'slendarixtjnwe-PpirrApl𔟦bmillhaiPck-jobbIo-Yw @®i,X20,00Dh葸ҁeyZoc93urF-seek٧C(s@ycYlldUiȎԠaInqig@+[赉Wa0hH,unchtͰick\trawiJradi觟P5>1w?wwq`thoday2wPhullCta Ҹs#a飵PenvyٛVar`8uhovelo8avy解tooarer)ct0t!Pworhap0BvȞ sPJnPu01ChHtips":flostesQ,iHolland, (ranceeretrugglingorheontrolfzdeepcaredittlerPsideratiPhumanity,onor, Pestyn.ԃ`tall,)aightiXMaPjNewampshixareciousossessEng9]work9buildthatleethosailsSytoiteSoceansguns,nrakRodnedproyuccfullymaritimestigDutchڌSpards.omescolonseekyalav9would؂o2"Rtl 0ber`3335c!diaeorth &po;95l115ach.axڄ@k,Z"broadrrow,aun 24on 3捱from*gr1ybv8qmast0Itb3waonabofifteyearsHurwnՖ`StsovernmyhdisHitsvlivakhnxuryrfurnishєkne`avy sels.Pa7
OOOOOOO#1 ??97jufy">grexnuaq@igab諰eampolpNdiior"obvxapoڑ+ d((h8XwxadPo]mpl0rafRase(`J(irsHrK>t] gBHAmHc؛ces gPevXI.s edEbank҅rod'xeIwrllowed(depthmilphap!???98?Yw)Xnow Hna,eIzlooҶ0Wht8wHX(eL3adh@Kmooth,unnлKlaid|ѿԕI8tBoxen—sm;oxhryoke\tt@er"draggXdYrطHliпjuntsprw㶐gP`@oproyele .anqfarЃo鯀nXpsmQb+tpisidfrak(pati0u8day%fl(orepeplY*stop@. i#thu[togȅ&١w"-ꥒokilmhelmp1A4fj#¢*ȇ`ǽ8ի뗛cihN`Y. 1Xn؍eaamphibopu.3FARMER-BUILDEROOKILACET HELMWYíBcoXbearo@0acco vȠ(!erȠhton0oCbSa,pswichisburykP@uthݸhiefsMassuts;LondCo0cticurovnRhoIsQ.ֈaypeop9to-8pƻpa엉EngɡeeѲڥXftrefern 0lQwo-maq@&P)wШٝnaibȰuIquare-,kp 5mainJizzmHbarkXy pur Ю--iᅹ"@uc ftDn\midҢA praIybp,rry'&"te_[BdiXboiAinuchooner,utitho@aowspritrib.ƀHtheisheries(multitudefmalle(ypwereonstructed—suchsRluggɂshopnrpiebug-eyl ck.omsurviveo prntay,ndnanyas!nah8passedisuswhilhXQtselfsow0nibeenurasts.

ππTimportanc+hip-buildingIaact(0deveHmNewnglAdid t trelypЎ؃syZA(icanXlone.ha PHernationalrap)ginnYunderstoodpu`d3ryeopwadtcarirforn pPbrb vearticlp0exchangJeߑve@l PdompmaXwooyagcrosAt虮besnappup9sQpursbeyoseas+orHac`3craftload[msparslwayde@xY;tailaomismarket,poЋagotak1ht P 10PH 11ews!criasdcoirbY@0ڗpliPgr4h0owCwayxpla0x8ooocQr0$aref="$00014imiXx="5"@SCHOONER-RIGGEDHARPIE"Xtl/sbr/>IW?AebeMpo~:uzPdikKreado`pYuʲfave@ aougbi1PlemÆDAef2@xXxark`ke8esnowෑbrigX(ape-x-aft ʸn8Isqusail hmas`Y *׼twswex񃙼['xholhdiscarded.hedvantagesfnewigereuickly䁰ovVessels 8ryingtkfoundoailloser
P 12 ππBreسccoxiY0scRmhief߫*thoughde`r@ngP1иȔ81llYᕁбtnthropCpaѹ,Prwrs: "workhaccomph˸0ٿGGGB3GAmXetc.u(Dةaذpn؀A m,LܰXIkfd`wxrlМ!0hownp(exaЭі6buryporn 1141؄Hhi¹xwP@&p;300c , gYP;wo-r،r;ڴpndكHNupۻrtim'HlankPbbfl250=wʿIloa(uga0bagg9cot`I.Hlco\sp;Kh@Ruյcheep*w@0m'Hc3vesh7law.âggg//gg`y 1642- d8tyl8a!lau¿ir(l-gp9erӷzMaakbrH샐fruiiХ@|aeadvHQΝgave螐rhrlijᬸ4rur9pXAsa0@lgrimPoupAsQbLondfromethn`angjʯarұhbe0r. idvظ8R,si qoubtIatJaffaIEngKrayⴍur)mR af0˜OwwI98opnBeboHfa`[I(ahm٧ʚ ongt`!llӤpBIre=ȱ@u hss(pidly佰l8zmapXt 1730gotixte`Ay8Rplktoo,u@YornQӗ\@e}wasentre.notherndustry,essommendable,rewp hissYshipping Page 14 ππOapidvancGbbuildmarXȆC1gard}withnli did8I@o0@@—ےPywhollyHxd<Ҧ1y`in(`worksob@fࣴm`y.Ƀтu ts no4ketgoYipȐnYqc2acXsЃmzp`u)o)ufacelrticYcherihsi!<.6ear imq0u@pulati`TA HKceeembarrd𱻳mHriouslal0@vasjlnaviaw`oڡW8nPb8officirowntPBsuq8tbunsx,wْJma-pYrailoS1770momox;g=revolgaink777770IclRuzc^xa8ab$H0ai᰸P 15Page 16 ππAnoruseh_ctenheQs(ralearscceedrdeclarrqpeace.ɉŽbetpwhich퉸8vhiitell-organd,oxnjgoPnm8qprotectЌHenc(tss nnds,hippy-.utaf TreatyPp`hailthirt醸epe(bpuStateɒGلiadowanfedcy,nobn! laHcawxlyJp?unts—ҁknown.͜ȋ,ʅ jealous h ,ossesshtrue0mmuniE3seekiadvyatBexpPnborBal`dyxginnoPopmomsel)Hyactich؅{crPlaviglawӓagainGrit"CxlЦodHiry,SProfFiskallw𒡦Ȑ؂тQnew0u0Co@itusmHrecog0d3yfirXmeasuqpbyg0 tepLtakryןՁdipiPd08levgooCޯy`hșϪPtonnYԱaYs' lmo50H.*giilعU0<9(ybroad.cmulthrX,spP gir Engyriإ0Ⱥ h@awFȰH79i@eeaittbPpXa! @AlgicPaH Xavow pi@I@`B(Pda"tankek٣a2tP8voyp!a`hdpxlleto-8teamhoHheou(liaotwitwpaXInd)R 蹐rapo.ñy g *ȾnP*@haaoz~opX oup0ȸB`pNew9h0ȯxMade5,Xome׫9aXÓ(arH ˬcH,HoBSwaشZxc(8h0Xpic9uqbe salabxAvrsh{ea,(silkȜPcAnlugaz)duc$ToIʺئdidvG0h@eey;ϻ¾IHamburg1r`tin@1785Bal芒shȟPIStP93CPRȫChina8{AtxSalem,isBomb`CalcuttpeczbephaQp0ș!bruPe1oOma9 erpseBs鶐yaȵaƚai@uPwithm ޴*t q ndus,țXhi4obH.


 jpify">Fpnty-fHsucydopptuű`st—bbbuil2ط<X0,hannytherainfulndustryursuedyXemericans.ettasimehenveimaginableevic@employptoeepureop8outf*ocean-carryingrade.ԃBritishegulations,ich8ni@upccess!iort9ereitatFrenchNapoleonicrsa
Page 18 ππAsűineIخfe Beyooubce`feuxÍStripekin1801ԩ)vPNXYorkoʺ 1.torfolk2tfg)_sloop-of-Ȃаveradionngph0vc`zനwho0at-lobluejHePyeЁ:Pͷiabٗɟ;զP9up.ϿrcovetousupPourbodyr-hɒ,xrsoH=shnurf,urtuye`s؜\buiџ9iqoAigHؿq3ogrvZny(swdow"IEb𒋯 سHagohnptu A&AE;oluAҾϾϾϾ20ϿRarmed¾cuuo8aninumb`nźkơWkPrudSarahm810un(OaɯbelYpeaceخR3,Y#ink
ππItsotossiAundersttituation whichRAmeqnail`*ownerqthatapxediAt(nowledgznavigclawsbg8oprs⓰FtradHvexIn 1793zNapponic0egaxcontinuȐinrupqs@til 1815.raAŒhiefantTbetweeBmw*aPa21߁޺ϺϹϹFm'yspit@XapwtroktU?y,ai 0yce0ar.ȼ8peoptarbecaus㻀ipؽB)pcruisIqdrn-feanooubhm:oprmiurvMorclea1(gworVnavy(bviousʻrabIJSolf-of- ordse𻅃ȟ`ex f;fisc0iheacorn,hlټ؅n!p!bopMIsؾahX-HPȿ@pjun)obepe(izeB8StDeYheviron@imP1806@s 6h bunwilQOOO ,(anrrey upMtexpenp[UniY!n)80Hn.ɭIpectvel8gain(haYtabuagg@sQitcg9hVogiff`uspan>Px 23 ππItabothi`od (1794)h𢑥&navbegun;@ enif`dsp0@fxͭ_Xb4pclian hfi"Page 24 awFaA@X|.ƵXcn Pѷ` P0nufd-builQ fr alXH٬cod|em8y݄@mhQsuppؗoJX)pswnkeduclay@yshCG dispd @`(ful1Ծz5ocюʗ].et+,p(Í0uel,groW&wollPnes.ϜIشd,seX align="center"tablArder="0"ellpaddingspacsummary="TSeandaveszr>"ys|wyreritain'sro domx,Anotailutyermissionprs.Page 26<ؐP="1em"Hp> ππ800hnumbOxkcoi8trapfrن!’0nnqP972,49hgrowxѓ`ɢhXpulfromEurohaIȮitpobabہAimupomm ;tk{ZcxmtaȔ8`lteptٻ(Zrz)ȰH2maؿerprissselҿ dPigmP؂ZrkmouЊ2ȭseng^sspporDimcེ`$75,000!Pÿ25HKlargЌP9i4qAgX`raffBa21erXsloopbuilp8DLHudsbetwehNYorkAlbany.ӱ:1papngonliipcupaek_Zm(۰ innov8supPbedHvi,77737728jnhBosȽcommun*ɾxllo؈wagobsmmow*@AinAɐN{enQnr߷Ps⾀ureǯǮTYo`esuoWiamrah,L9ougadixtyreatquare-riggehipsnommission,everthelesseartilypprovof mbargoithhichresidenteffersonainstoQb@outragesFrancendngl@.houghreroseaysa orld-w,tseds—pcular bookkeepingde\wererimitive. "AoodaptX,aid̈́haxGray,willlaoafis`oWestndies, gpXstockab0arrivx,urehardols PsellsZ,bpawheurum,olasssugard Phieturnfu8Xapaccounts.TIaighbormarket, farromnopolizAattȓNew:Ys.inseВYc ohinaorlktea!eoyahwarȁtempuousor@occupy+xthIn 1785"publicaeoa P28 OOK) 771/justify">ѮXdech u8Page 30Indepe(Chronicle,fcto2791,ppeaitem: "UpwardssevpyZ)vessepلthis[ononday,orllartzIworld.S `criptiveketch,rittennQ4ndrin)yMassachusetHistoricalociecollectionsayancer ؏݋e:

ππTharyharqu,hieflyQe pd^town.ϊRsxmo dinguish!s€xpierrLong׃fhichx8PDeott@xSt0reet743Y0obor.ȗqcip navigawxXon;f)bursunY;deВycH@8irgoes. Dp d!crowdwith Xseck notn 45B[מsmicraf@{">NeworkBal8ore,away;alem,ull,Чsmout8 cBeddHaІa!yseakrXgp,oirosperousdrywaہr`=Und;on@ue(thoughru0zaChal㩸uryflueXpJx9legisl⎫raoureople.p8Danieleb,im(sHeafagåawak`)counm؜,ȜYnۊdrifɶxsHs 3vow(antagsȟK{a0t $ometap(reppHayn8,Wrudder:helPtrackceaexpHrs)h뻠HBbso@knaudi`XTX`EnglpichAvivac
Pa31Page 32 ππBufȆYank`rpaiXroducq꽼∱.Ďpdescrip`lifh!1840,@l goorTճHty廹itetڎrgDcr$brigPilgrim I edAlxvariohH cks:oo">Now,y𽘱begu*voy.fgeHwellhؽ`ҋY;don'x`hQafloaA˸do h0obr dulik0en4nZwxenoughIOhL,ɿUpurGfil8@owwblyalatI' gooaGojboywatch.ϟϟϠϟϟnotrnblackgdism@was dxAmeri!)pWP8,koPPmoir`t vQlzknowx;reiZېVKeqycfwebyd0kslumpagan\Е PupNEnglщ!infrequ lstal8Ƀ\4.aiar(dHaduȳ𑐺t 9+st=reeberths ӜPcifȶfromslergychuradaPeyPubPhow9ymo(unusu(AirepM۲jox@C:JaPage 34fellows,ftennticedntohippinghilenderhefluenceiquor,ndlmost8waysomaboartlamomP,uchworseorodebaes.ԃhQaett sortoccasionallymselveslucki؆Rwitharew,aveftnecoPmanyurioustorihPJay舑sail,unabPwalkshor8rdeck"xicat,uldPd@spr!rigg,lambupshroudPshakutef،perm"difficulPut al.

_E ττɄjustify">MAth(sg0o'st u<9iz5letolernowadeؗimkn.mokypmpwu(gimbalslf-HhtXeP`—anpart9k,aafca400pndid؜f0dodquHersÞhapX @ietbagTcondifeth benvoyЃ(`riapprr疀nndsathick,h(en衉puHclٞ"obacc܇KlldHrumasoug@osck8ov4foobad-)@XHfaR" eaq1mermyptobarei1eepf1ɖbH]upQor@staHb, &t;d0,[lobusedoubtfulffeHwee`}moseDwaL,ukewar@tسyvphogsheHh8erequiurdyٓt0uevV.ŀpl{Frank.ulHr:I۹sɪڌreak oupй0biscuiaɚӁf "tB uttwo(kim#umuhX1hro#top\maggotzeжpetcIIy` a)he8riyXѬʪracsoy(ePi0p"ƽxtu Иo*sucؽhres刻<𣁒 vi{fuwAiinlxspke sflic`,faHsZنbPl㔰u+ne!Á typhn.ɘ8kill!anshipircscvoid7xauSish͈ӊtdiplywwws6wqwtaxԆ)*suado`EnglAF0colonipganpseJcarg`e0pTj=0(ʶ-solH{lawyr h٠incipalػpno ctHur1hi.ȸЄXPkel+&proBpouyp9opvisgKق.aldozZ)edi([0renRAZxposkx(rahf)ulHex`iڲ lڲXmuBmyQna ֘1pYhoi Sr9`xPΛYhrBo0m`qQcxcab-room.ﭷAprHtitrSalemRev.eorBYlqhdH+Xf or1engZil8ul`raؽ fac8ies:gggʶWW">AznJa9veuieJlitk(;uddenispersedoveryartfherientalorld,nOookIbarismhichadarketahore.Ԃbordcommerci%eceivsuddennlargem@*undeFintellectuVerwimi0xpansion[rewarda(erp eightediscoanslin\wipep HoughAloshiplmostorasking, xests(ere@ious snoolaluespicsvisitapexbyivilizatEZ-masڐ inreturnnrlywas+ustodiablHmInodays؇PImxpSalemys,doneYwhomSbenŅIhant.haaptai@htanhow ntrfihi ay)teethrmonso@eko,replihXɚwelvhenOIcou@tak dklunobserv*ll,allacticxpurph@Sirsaacewt`himself.
Page 37 ππ "9,q1816,eoPoggeshco韣MedrraneQ'Cleopatra's¡I,'gnifyac1970nCexcJIwoi"Ges lackhoko"onsailwi(Bowchf!kYHpetqPkeeΎrofrs.Rivs`timhdrp0@nڰ!(1virgxsKfavoӊȱqsouKunknown蠜wa(18Hli hcQ(a(;d1h`pthha(hopK}Z08)pywaAmmollowI (BHX)littX`PprIsuitnot8>mini`XNsavZqsu`cpoSEeXrؿ ulzcadTgre qyvit`Yprofu`P јHbr+ܰI ribu؛og®xawlbhinaunrd-8curioiXfr;avish,aqunartnesbint賐.cߧߧררTypiritAyg殘owsPceat)yXZhٝbcadanzvxd(depibC,Pȸfirf8-to-AhlXth.Ȟ9s-schxýPry,;IbIslRfeiffdvyleGGGG@;K.؊ Ibetg!`Kw:SutlڞteaȞ8dh.ihI1Pr}an-sawԑhwarYrws.mpɬ em0عh*,HrryPmQtopHninstXBtwosselб랙H lefpf !Hõر1awӿhisaȝ表l)u.׵Aؘoahu9}pglo4k:-dstig[Pq38 ρͅi wwqojustify">WI8ntelowhf"pt cgo90bed;sȀAI(nqoll,fhoalogu)place:???'Well,ÅK.1atXH9dohxt?h aȁ ixPurs!pbefyZzccord4mylYtiononptmi.tia,t9timma𚜁)ofavorBchange.'???Heplied: 'Mr.Ê\donЊC@ko8 .ams:fathinksQuswwIo'Pyouolvstruggĭ13die;{tay-Iyhagēadowpmebrz`Zps]Yrpportsympathy.o,xxsew)ߧߧߢooAh,'Pi' ydo?uroh f)minute8ccyD 2urc߭oߨooo;'taksaIJsুjpa,!nXYength xhaxӷhlor.'ȼonsJ e`on8A`xixn>P 40P 41 ππ "Irefr0"إ/*qF-deНJlod[;В´!Sup՟;;husSbrtieubold(upbpaHyh8Glp?8anџurishsw,01o8Hoice, okXE: 'Str,yArascaIp Zh.'^@imtive- xw'Louisa,'musdelib\Xu۾d.ɥӻȎyrЈdischYȪPi)effкǾemmaz ($gظnfliccgofbwaDGGGGGGSofaxeezpgw Pڿx s`rpos`Iv 񳺵IawStar-SpaлXBannbQwacefulHؐi竈m( alsi􃡱psuءsail9)ro0XowշH :epWdrXs*AmeripAvoluniw龘ass9`yhanchSbovzetof-marqH✟Phi8elphia.P 42
"INSTANTLYHEUNASҀ@OUTNDISCHARGED

Page 43HarperHMagazine )tshown)x;UpStoga,߹A݉`ithAramo@whomereeveralecentlyibtedrenchonvicts:

ɀ"Theirstayutnewr(yroublesome,wingnart,ts,o absefmx,hoasllbanddiifterhours.uddensePdlsoncommHer,ardisaHrah, 'Takeldwheel,'*goforwaimzYailor
Page 45 'Ngo3e(ork'igang+immedipmadxmonstibkj.VhbpassXthropeYxkN'I shoot.mt`youene;AtwX i(?otoP'OO__gу報ai𖘢adirHaesitڐdva!8nBedgivemoih 8(ir=urnisqui!solonoarbwrqinashacktoomѩxa#manh-Zirl.scorߠTɑdbs@lil18tomachAilQapdr@ٰ0gch@sycuffpЩdowAqن8Asimihqz@W:selfdyPlysofa`QAIƯ ҳrnexinu@asleepOdffia.˽ggv__onAocePbeꖪXdeflsharacAinn8X"sy@Ќ+pXg0ypAmer8hip-madXA̵MBrpnticI§엢BporΏY(,hknowh`y8I9Pr.marke?tXhaffbe؞ret.¼pygu`D+v1hip nٻalmظ*it`gٷam pAtlrto-dayК )qc0uAvem9ЯQngѽ }ٌ-i1iLYrpool]ha`y 9annXc Pa46P( 47
ɀ"A 荑impr`xbeeiuptmrigv elywaer(.tsu1atAioashap@afaKr`Qo-day3substayttadldpghoop-quar甘(disaharXwithnug-sb@ bark9s; rptembF boScurvh,abovCh ehvogueӌ&econgproHbeam˧pHbottompmuch1h!tendy8pd9Д@8flofromkealf-wwid@ mopulaollow-se(roducfooruc𫀈ztso !wex#sbowshwɱroXf'ƒs ptu2givPup.whadylؘذܞshx,`we8ajoh Cr alm *(hrn;`r@yovopu)ʐX'$Xtp0hshymaОim0hou,;bropؚ Ypwo-fhngmpgꂊhann٩*49@re;rrabɗead0ta˥khsjnsreacXschorBalȦ t oughHԶesmre0t䯾ʬ!ㄴqhiHQi}͜4crablxak.Ƽ罯SKtechnl crip" gqZ9 wjzod,A3rf, xf )whs1thھ eyp@oo:`aaxi}ȶpoet, t˸TwoوB M:Page 48Notndhb軰bZeau+PǨĽxehaPklnupiexcepR1jhpadyeezn8l`ٟtd8Yohgላ齘trskexxlZimenxqvبtudIn ٿqH1YlgiouHovobjecworlP 1fseagoodȎWbehel`b eck)yourw倁:wouXepar.Ǧ">Ohn wtropicI@KeyYjib-bop:dб"finiturйHo`Ӳ`otheoomorongime,dmiriyheautyfrsightee.eIsoarutrdeck,ouldokt+hipsyaeparateessel;ndɃrosepw@r,upportednlyymalllackull@yrami@fanvspread配beyoowealmoststxeminindistinct,toclouds.ԉeati!n(lilake;bltrade-wgent0stᇙ(th2yarn#dark-blu`kystuddhwithtropicalharsڎp noXubPripplY 0temails ؑHBwideh—:woH- stretcon典!1)top1W[likXsM2ganׄ%GearlPabovhk|royچls,kitesly6mSȜ3ttl,:apex-HhAactu@ouc;|88hum(h.ouie8too,jzeaxёȔ[ezHthiҞPhbeenculptur8marbxy|notЋHZmroti0$!a蜋surfac`{;zeva9v㦜exxedgEʦperfec e8zhI`$ZIag؍2rngiwhoHÝun d (hQrougph-of-war'sj򩲔gaz]ow)lom f:č<2: 'HowɈ§irork!'"Page 49buil0pe@ sgB 1814hoemPporapupoceanScinu񍺱úMCivWaxmal9eguXwausinxãPmConfe@cruisepnecomо@hdXgr exaprt`firӿAm(nsaticHBBIɜHlXspwѝ`nnYpitp2 playe@Thixfas5,IsaacrZ&0;Pmy)n@rynthmaґButd򎨠`Awy-thqpIh@jv8 tyrecof(8y,ڇ b.Ƴirtfi؄)LYpoolnknownԉrnaum.wowwqIcڎP+incHzJ_nԟlljgoڬXn@chece8١2XnircumnavigKppvewBmيrryb`kTPZeĴorcfPڄryat)شjossibpti/biggxYHT40095:nach.Hgrewaroں tst911,8u8-d`e:aopfA p-ghcast(1/t Guyannng, 1419|#49Wiam.ebb, NY!ot8co(`)ɟ)"-Wyst8oo)h`rHPemҞ .Ʉ1,ËkSllBaaMe.@to8@ć[Rhock79.6e lonqofPY50
ππS "FlyCloud,uilt 1851;nnage 1782; 374ilinneay;romeworkYSanrYscoY89Qsours;ye폠 433-1/2,8tduthi2exac24S,427ggg//gggaComet//.836eau@ulodelBgooH;[332Jg151 120(ecveOOOOOH#SoЛHfSxolm242؏ 6,24522B;X6OOfkpហw 398GGGGLn4208pߌߜdrawчfee0Engxoal tai troop7ꖈe sailYvesselsxI16q40TBosH73 13 ǡסǠJamBainx,515OOO6OOOONThre"c1toricaQDonaldcKayt,$mamouAme(q-d.ԳHfigur8showӲ9yЩIJqspe thcharPzWWRtho(I´ WQAQru@aritixnZ.ź yoy𭈹9P51MMassHusetsAfafie@S(akek.Ӄn)esȉJnpoI(`1Puget1p"fellqo0kaaكz2""2
CHAPTERIxh2þǤǤǤ3ǥTHsй:S`o8eam—CPMXA(cQGepopul2O)dC4eor'sottFWoo8el?Cboa9FaFitchul0Jng(rugglesOppoea@dmiral every nationality,avoe xoesikeell tonAndrewackswȍxrved,varyskillst1oakstou)ire throutumultuo(s.

ooooooY gga_justify">To-daaltoП߀rimard$d<;quaiw1gogo*.ԡdo@,ncoopuleemeserten(n>P54rkٳxQ@rule.oubhxpH9,dxѿas ausiness.nheayshichaveketchedfirsthapter,boyfoodbitsndeasonableducationohippbeforemast,asairlyuЂprompt:o toJquar-deck,aightshaf voyage, finalxowningiHwn.f 1860 (seondiYs)nged.teamslw!cost8pbuild,volv@geestmensQiriz1cA1EaɌ
ππRard.le蕀ccxfulertoreBRhh ury`henttm;haahund(ookH erpristhusescribhimفe昈avre:wwwډgg">"pu铰cu-sloopo-threؘ9burden(prwo`Tsel"t DiePr(QoutxvHer;takLEnglish;H P 579GyhWq@AXicQ8or)Dengagتbr8Hex deep{8l`eacPoh8fhoaCbٟ8strugUZKmheyݽifossiblqhar0GeaܵxhauZpo8l depe,mȽʸ nomico ϴϴϵϴϴTonSs`cX(z-"radintol@o-x{mcost $2,!tp˽favmhi,I1nsiwᷨ`ft؃Arg8ci@9ҹ upȂAbohKQaon*, likeo 꿁hrch!׉1roHpresitYkn`,|p0 fXәzparvfewshooieaˬ)pI1OOlbookocarНl"peopapopЉƗ'woulxH:impȺCcehināpJx.¾ zadop ibegdec0" p؆tenurQteelyrullhhiurPage 59better—than beonstructednywherelse,uthusareaveotenbleo0ild@emsheap.ccordinglyur+ers#rei‚0_ionfarships,(asPandachts.aQalridsaturaldem`hat essorznavy tnme؃yardaeHlaw:longra(@wports)UniStates̋.Ԉlakep,oprodigioX8numbYډhvityisuree.Ž0untilith8yweflag(@lmostisapp@fromeng dinK"Lz8ystancpjown8kflyxBBritish,~/)Ps ؍regiXewhich aYczenXoFabroad.hi8u⋈ampPo@otectONꙺdriHڈceanAindyow[yNJyprep*vMorijwiagafig МYhigheas.

ππ[֑`i r(1792:ww">Xanidɶ;QyimHerv!( ,lspicznHu9opbXnames!ԋ)ٷsɉʼA`yalock-I0nog.#OOOOO">IndetuhX.Ⱥ'akp@gin8ty und8nedue`Inoq-eniB`9\!y`.*`eɾ8buffsŐྰA5ortc`St@YNewʻhewүm).ק+i@8m𾨳mz ht겗lpadd8b9emyeDttachPenshɽe𤰱-Pelduyo͞ȼ@Ѵ$DelaeҮ ug,875wy__<$pencm9tucit!soۿ0membɨFederCodjour@vposePlete|ful boilbu+)no),t>;demonᘑŰȤhb߮">Fatrugg;ah`;XcrueltJohn4lab`perfeXq ;؎uppublfavo0vp\BodawvimXhmeeôdoh long-fewant (growYJupfr(coloniestrunglo1nxtendedoast.ooadsereuilDenseorestslockthe
Page 61 ππtry0makP8Iinc oӔ,derniXnea oo#yoLt `oubt8Capp(dB,Fulton,w(mselffirXs)rt.laharrhruBaai1543;Ger`hPapH韘ys,XHrg1`oylqiuss(ju9iJnȢ`0Lxrl,737&rn-elᆚengrJp@zY @exenceSSym`801r٢pracal7IDe'Taex quȬLerhapswen8_lsԦssibilXi[ఘ ubdXlopcmtraiox}J08@deH.ߝߝߞߝ">T u[pAapoobYخఐirXaxrC3agoeoovalub???>2?asw-aerT!ԨoudopRcxzEssstbronzθYork'sȰ9yoGGGG@FAtiȾHRobx預r(,tojusyģ..ϒIs3ȸTпDelawH,ʿ0suqPotomac,׷`iLe SavannaElijahrmslwYbRhslPmSamuelͬidxӪ?ҌHxoF.craftimɟ8be sPXpen laund'''tr"tabxbor="0"llpaddphcsummary="TB:r>4n|1ffaȷW,fleaYo)tune/"OO>BD %dH)࣪wih*wa8h8kiprep0.ȓ;)XIris(mmi8nt# Pennsyli+765. |0geniudd(unus!giftsYrawij;ҷПfollowMXq){iXhwضɜ8tudyenjap׹y8 >dٿ)scarhecRaphaTaikopXonarrpovyshPARcie4 rnay,w@ihimfhexpenc a8mUf0п(JoBarPhPP8c`B譢A@qs@ mec0Jsep!p Page 63 ππ՛weLa8iQculityT03Phsophical@tyRotdam\Amcpρρʂla,inmaticerniydevelopqͤam-engUnStȝ()qupoenj.atrob#,reportpubliڏ80lTsacs.A@a,SMHޗchadxdepailxyetiresubsidmpelloa؊@.\B9LficoulseכgenerobYњwh8 ٱ@rco,s`icwelfuel;XPXoccupies;r$tencʌµ1racзvelrrq(ky;uHk1nȎ in ifiPg`ro2AwIbocrnlm8rougHeerixMdifhx0ris1fromiabipaddlehark,f8;&T:x 42gg>ynѸ`rviv?9ictЕnaVxazo(PlсPWggWsowϻ̾(hfavorfhwith new C,beR is resx[acqu)ʯ\ima)avigNapole c@gجp0f0н ),9oluAizy,(havrok8B,eгhy"e~Pemp_@SaatQ`IpossiZpobuiHud‹Hxown.erhapsbi(mu`hanyng,asοThomJef—Hwаx ppo(:QqҸٿ8rXeQl vi]HdAsoc9hospitabȘc0ary@dp.߃Qpy %l*y8ciaړ0dliPspe(lv.ț{no`Bmono0y.8de)be8eqf,q*!influ&NYorc? exclusxbɟqrk`Jrs z.eH onSYq!hoЊyshoulYodu@a0twx1nmzia(1801`j d.rtn8hipPmnKPgQthsϭPeڋ1succoIH@ r]fieh01.٪h㘩0sphi8+When Iasuildingyirstteamboat,"eaid, tprojectviewedy ublici8r8ndifference,r Page 65 align="c(er"tableorder="0"ellpadYcsummh="Truths"r>ouldou hchsaveinkdtd`P">AIear,oni, xw8X._ p imge dex00031"`THEOUDAUGHOSETYXPENSE"i/>
____jYgfOjustify"Ashadc)passailorom*yarhi`ingresXюofPoixunknownidgroupsstrangaYМrcle08hdariouqui(s9iobbZiswehi2QguunimhpQcornneeXridicuoudugh4rosXt,ense;dpjes)wi0calH֦ߦߦߦ6ߨloss\bdituȃP˦sxpepL'iFultFolly.'evdXjg@ouragAre@krqoparm`sh.???[(hoh-aagg@㑰dXphesidisnd9Clerm`tӎ130etng, 18swidphalf-decki|vбa!yl0roPHanpx`y8onreel(fiȅdiX#butspur,pptwoݚtwapggI18060kcЀ(`beе踙nuc.ӹȁ0l8y!(rhاtutاhtPؼ(me;ؑoῸ`Napoleonp osuc(0gX1Br8XGonBdop@torpedodagaAicanWt׾ؼp.'xse@b!rivد0h;LivsUHf@uuy[ٱ ñtrE@Нoyharf,HpreؖX9Eu StNYorkbmeanti8gPIіano hoy{vixkgɷmxtil97ڞ(Pabiy ѐxzQePuffic(arnoCAug 700=4Иepoch-makvoytaQAlbany&md;150ss rhrs{rty-)8rhq@paYloopuHudجeguWо`a^p~R DelapLakhamplxdlop;u`,invXywoulmo8rapпnѲ Y결"yfoȼ3 yAxAyës
Pp 67port?___''__">Ԓڨoxbtec⟸혟YRbrZ rinkqF9rtt1pyyXablx xclus lIbHederal_t׾׾ stify">FromheayB"ClermontsreastedRtidefHudson reasoheck進onquestwatersy am.pnarrowIriv,crossmotempHuouaylongplacidLIslandound,Pifrardnatimort toavannahZboatsa`iry,yygindissolubl0oge.urixenought*LivHston'onopohatavirit)extens vig.echanic mbRobert.tev ,n6caami xauish`Nework iJ8ebuiltȉȑ߄fsrwHripsadrovHusefulnesЏho{+Dbecalarmbeganyceedgainal.ēbout&,-okiarQyPhillphia.hnoщd op@entire1fielb*bin*ˆansp:ǃes̓[acticabilityWf8љbwihA0azvhel ultiplirapidallmerHn.ƁXxhimЕetphip9,whichۄerrieׅ/.n 1809aciwith΃olhJ.osltoبpcr su inPage 68 ππSnowҿ)Gӹ@aqnةXIsSsCsal9y +pbeg discuXpquQ`HɝuppfwouRub*oodxclusly—(8hXtld$AXpitCvIsKcoDfa_: *BitXᙁirm.r cM1eminډ!"25iSɉHudsursixhKrs8@ek.ONBRj@YorkWWWS9Wzfer Beaa`nsumTyA icwhВrslacXw˖p-Xonwi0qsplxn"Fa ꅣl enjoy`eXdifacodzth9/ed@al!turrpaiaLlux1j1 a`mortsWpetЦɯ+strHS+RanynunZAlbanncpec@csafebarge-Tcr8ȉ`pe@PlHaabtwd(u0HIgy:passengP.Ɉy(ou@i-rooPetyeetong,eckabinoradiesreXngoomIpromenade,h`dndviiwitheats.nefheXgularteamersli tow8itHlbanyitsassengwere xurfreedom@(nois`vibrationmach rllAsafetypossibleoilerxploss—Batthaommperil!boHthopdays.

justify">Itnaturalahsss퉸eAican,ntrammel0by hdismp8)convould `naly*eaQ(qu,cr!PYoceanyb.he ivњemQbusyw`puffs;%Gtaks!bul!ivasMeerranr@1ewrdeviceshipliyetw)NYorpPhielphia,•imore,avannahCh0I@v wis!f(ouxmid-ܣydaemp(nXlee񃱥хfs@Hbaieem8ĝ:primPnoIsxwh+ LpoolXtXL s ncy.ԅcificuremqgain0it.urix5span>P71 ππ)Ao lfnbprejudicҽmispatpٷi@Jim𮈗(b,Al0уcqjɵor(veaudac)ourvqrnXsooI]zmomp9ut8zPJeniuorEmp鮐zzasM߳*ȍsWWWS2WQsACiEnquirer,*pef)iJauX`)chazardphecy)tutiaPon:
P73 ɀWm bulHat8)Zitnt&md;H؉rbxpepyuelȡadm` employ2v隈rdinaxpack service-nateɬm`pin0 uа8feasiJ51Xfasg(afety,mKditch D:ػ*moXboeٮ!rCsklnowㅠPI.Ununlyxh0prkYdlosopn@d;qsm behso0𑹟digzIx`@onU|Undt qattle.2Ptitrufu©Bbkgrain,thKaѡeȅdxfitab9!p @homI4m!imminwho w#'tweckUyylagJimpelli buibigg\crafX cXhrongA:lrҾluxui8lth@ex {uppۈdademquarflosorge鴠aƷhulub`鿠RIpalH` H tsalin9jlcivzpeopwia acoa`outdX.Ƽ`a\@e sexQx@spioleaTEngȐiKtookXƕpHPؔhcpb`wa؎FA 1838ϝɃst`b eaБ.Ɂ47OJSavigjXgh9NiIsecureLjnۮІcGaibe+NeworkRBr)wo賈)[ul8trzIaqmore+hPd˴ؼ)renewAt P74 ππE.K.aeworkipping ch,organiz`imanag(on+famouFold"aigacketsetweeъpىILiverpool,DramcsoallfromfacɌiІ)enamaf9populagx.ecogтIՈ鉊f1ayganstyl*vesselMrine8umbfactAԓ /-.tnosaskapit@txl@y=ciwhich(wohtXCcHIworlȁ؇p unitih@Bintm!prisxlon vlazard (no!er.uxdžnmubsidy$858,000nuhy1masoubasi¥aq1ciz#pibleseem3unlike蒦viciXtudr8g{e 0ulHi+,2condoextrem:blȄ'hkw1-sixoyЈmNg`houhalwP 75 ππdir(X9aQtqfr˸agime٪a(ڪ2`sels,asotateriallyessened.nixearYowever,heorporation practic bankrupt.ԁPhighpeedequirHby*Gonmenoreanffset*g8rousubsidy,ndisfortuneeemtoursuhips"Arـcamencollis ithrenc`te r( 1854w)dowltwoundity-of Hehteople boarHgPacifnleftipoolʇ23,6ĎhXd.h phreafSdrawnÎfamli臚slowҋ8obliv.

ππItduringbesPaysUCAntԀyUnitSt@s9tak@tritaorpremacyocean1sotalisBpengagȏXrad65,92(onWQonegbuild1 2#48, tit!-goaggrhY62,390F@fourc Qgrowcontinuso5d 115,00K__ZZxJetrog2m0!,Xl60—bei؏nfede`ruisersre;cH ic8X0eΥJT , n0hwayromcoastanyw2globpP 77P 79 ππpm(1902)LyhزᅎpHlipsucXsYreësі`non8a`hЍirHȪjgaubsidi߀ۙ{ņbuyei:ylgflagboPyۺlsm!jdiscussnapalaustwea.Ӻ;BritP}niI, altghlawfߣٜ*`.ƶexa,ttTsp0l`byㅀzeȃ׼=,'"a@ؤ-Two򥫵hpI9}+{n"Min0onkaZeka,x13,401Kepm@߽188787Zso-c8ilkeelr Xl؀( ۤ:brt 4t`w@eetwy-xeeܿxt@rQbo90,cdoy0ؽA despྒྷhؿ'wHPiYxParcattle.u9pi1ll17ca؛p)0@9Krー(AspxxAfitheedlqiS!rurc2P1LeydPteam˛Ŭmmedifowxcans0dޞIrb 8+ncipP-6IPocor(xHjo@tockIc0helO!.đi80)X7eXTXϣϱCОaߣTyeaPe׍_AztuӖZXsis"suggt9uXiaǿtocean(½orPnoTrequen nC1`Spmturmxihhpindedwou8pp`鹃ireghPonțDh7 #re0.

πdiv>Indeed,touldppearhat(eawrotectingmericanhip-builders,hilearentlyffveo|purpose,asestroyedp(.urdindryattainrespabndvenmpsمportions;ut̃9errrought0toompetiith eXvanishedXneransatlanticnlyn 1902isplai&fla0ɋzenjialunusu`priv8geoch(bHyAnot@existQInnsiaoftwo.yardthisYeHtern"NavigCanwpermit fPAtregrays' t@cqw0@it:pguatȌadpc0pcItruCallrrequir R hI =qsSbevy9eao(rIfarbiggP#҈o(nysiit`,햨1`cadgo.ԋmy1"Neworks|Paris,wxr(afloanow( himiІymh.e`xRTa z͚[pio
Page 81 ππɴ?>SFPsous773sЙdzs0p!cehn(pPl`liPK آr(Ѫam1elelnumbX124,271,378rosnTh1,0001IerPav`Qoserrems 4CLf 10z; 5l5)6ׁL2On 4Nc183M4352EBɸ331]bk497ӂGgg260,325s.oo">MdHngȳOeeamburg-al`moi"mrivaɇE515,62G@ww">HowepmPaZmi"atseeg( ȧ PahelUXPStڗt@rrXnpaholdY2irCarr轉Su auntr`ser†expeYItimQerga@wqIlittnol8fuqa-9elfpoxsmPlؽ4wyȐr.Ϧw@tHrz],EMexGulfHborH蹸hcaeophoodunsuPm r8pit{00FrombzhɊҾpay idoʉhP` 82 ππTfiguHinorabour(oled"shipcomS(operdynytipeoplOtotalegerengagfis(ies,Hastwisandtrafficfor@r numbړȔbhnn1902, 24,057elwggؓ8nnxY5,5218sJdomeXcalwad 4,582,683z, @mtxceedMk_ermه9NorwaybdJRFra0nHEngllluؒalean 1860 incidbl9018digious;ByshagyossY؉X61,254zng,`rthre‹!ɜpihHwo-rdq֦@@wood.P983aoIalr`y܀`s1whyQnatur(rsngH2di8y(tweǜwp-goȯ nuhA@XɔrapѵQitsPear.hough ya2multiplifmlaf1yԳtP(urh#ȁ_ew%ukmlccupup5yim`iapac.م aliٽpCrampilzw诐lworkPoPnc2ڸ8n-of-1u(a:J@pY-vf(d pP(uoUHtoЂHcipRmo8 Ioang0iBqnstrucjXpocketoÅyi1weډ~@.ȊecqȼZQMiE1tfroject.hp^A0\bKusPH@ΜnseoB9kosupporȌ0JInow򑀲 ʕޛѿAJux30,b11291each˽311,778.ͽ ˦la;m (Z0fPhl1a4seaboP_x)ayYiqχΓ,orlmo255,325/!unchHɯab&md;89_twicۘpIȾ) H!8imsyXИ,u @Nirc->ivԧaccombH(7 g̵y@hsXfwȹmplaiȷ#yxe Pp 84 ππEveglory,ihfڏqb𓍄nowllXgrasNǍpywrit,`d`ӃOHCeltBsh K`20,000n@Bueinczxon0briefpH,NewondConnicutwoHrouPfa0cxrisȞayѡHp`shatakormAo)amr25acho QAmYfla򄸆etweSe@lpCha.hРXwg8rmo@on-aldyʝpg٫ cHs8no*u Pa@85to"tH虨ci%9bverylco8i0dX0oopd@<MпRteels.

<ȺXt="1em"`> ππHow)h%zwecurȄHriple-screw,|-elp-h8-kWhropȖ"B;Bay, FonhkClЁ 0vColP{—floalac@ȍc!3h0"`pḒHA%)Ghe$Yоo𾡷I xyp ππItllenetoxniclerom|earachi0cmomodersteamɂІby"us*fig`(鋖proporswhic"irusinessIttapd.orpurpoi/nesax郬rawnromrecordfor n`:suHvel8蓘"DeutschlHӁCel,lth΅book te@to{)Am8cH@nar.ugivenvapximay htaexuildPhi@atxese0iervic0ny?panger fairXre`vtwiecyyrGGGGG@TȈexamPPB 3,294𞠔,wh2,859fs.ԣihcoul(urnisomtabXacpBxh8edh`ohxaudsHarvardnrsity@aMiganColumbiaP87Page 89 π2
CHAPTERIIIXЄ0,`"ngƊDfir(begaQ`spchɰ3pxXQbulk9ultimݗ b$AfП n؀sautˈqJaAH,irgha1619*kidnؿ0dbroughtererobablyomei(inheatterartf 1860—for)Jtrafficasyhibited91807,jrigorouslockade1portsmConfederacyuringivilarnecessaryo*itctual@annd.Ԇ0amoun hummisewhicathtfulNentail&ose 240earslmost⇸lesjimaginationÇ@ody߃had,erhaps,s liexcau0nd2twyacktamown,scarce@monitt)penalty,dijusticf felln΍hSouQlike, icluplongaslavP)Ғj,even
Page 91 ππHowrno~bu!* weq.rcumnxhrgcup/hXirnsavo8pëe`+scommeehҟhpeopl!8ealee@dinctivIeafaBfolk9A`ica.gaionȚme0nyaih𥊗e#cen, irectKpss!gtua8t٪HY raggr(omBannXhzarkemШHexbȧxE,uropehc驐ok +7q[arE,ƒcHolP ugٓle me`PPQWIIaɣnd(an8Mir̔ccȷx`hdie(ie0bou8@bfrequ@stdayRo1Calchurc0Ҙ:dev(mhAoy̆IonЫz2w2oAca:brumB(ouldic UւՁhsolaZYaPpeak@AolaะAturlin؅ظA Hdbuyɸbó¯}gu@wpai!xapXFi!,؁лadulterat0{oisop9zkPhiefsHce(ޮpdѦZhuca IٷIhildrmblyrzjS,idnappbooty___''__X𼃶[tyhshow1k(P92with's hsuchA2cost.M`qّr from PaX93 ππkApp-Ti}MJohnҊhpgARdnٴ*Opu0~hichoyrsiJ\fkrr{Desi Mlex120 tons.ateressels,owever,ereuchmaller.heloop, "Welcome,sadapacityf 5000XmolaHa+Fame was 79eet gnkeel—about0largeacht'sength.n 1847,󄸄 turedasBdimensilike9se:;Felicidad67 ;Maria30Rioango1.hetrle8ndeguldy8w,iouldveepermitto(rry 45sore2@-halo0isxO7(iuted,o]2Pah95/cogn|bdictxZP{8rcd@8֨Opb@8*akiracy;ni!xtrestrȰhoRketho0\attaiIaPAY 8cТَppar YsȗdayNero.

_______S ϊϊɊjustify">ShPgȱ/n-wise,l9phras 2uүPswelprougBmidd؜,yBcȪoԢJahfȯgeAXٱ+rik(9hookefʿ8supphӾff gi aJtrAfuru(yRev.aXanfellillغaplB8avy,з3hpCsCleopaEh captiۻʌuЌrVenoڻ³+xxZfhir㷈r@suitpoanɿ}uddnirps8kix81cldelrh,yCapGHop8Pƈpliberd;jqucomBn(borxbelog`.LnEs͉ journabe1iny@t,hurAwretcaZuram`o`lXyar(lengthevfeebdYon@{e-halfnpib8mak'8uYB@`@vmмi span>P97 ππIt ȐarazilislHAaw@alslPbevitselfalleH "AmPship0ccaspnctsaYsPoybplodmagnk8chaX Adeck,g䏑IwrؖceHwash offama?iccrewpigot tmad b,0av{Hurg(o hish.hda(is6@di:m~fetؤusimakraf@z¤nhildr0jpu (,lung!isehswamongsid$guX[to䋁.owrk<(tXa]uppores8@civ@z«zChHtity, FPPage 98߃߃߃߃D_'__Züday `ѿbaptyecogn2efxyoaGuwhonducau*xОsPxoidnap.upurPp<(skhuampet\abQouR9valuʹY.ԈŸnycalcuٟvelop۾0uthonoroPleVusadf2qny[ыP#1roughqcu sھrtserbxw.ďู(Sxi ;⸰}A0˽ aHinquirAMȈ+bɶPnoԍn legؖ"ry썙ǣǣǤAictuhqx!௹ݱimoxbeEnglishoufom Toyer*y W3airl[*tYano8ll-knowɠۖtookpappl(@momPȎك:two*Zsi@IZejPage 99 <0eight="1em">Butocruplesnteredheindfbcaptain}slaver. "I"yille(youerlbuy,nswy,Pdoonkidnapp8Uras ironsrthr(elowхnoisomeoldpthBunhpyXinghahP1re.ultitudecasPnegra-dealers,seiz0isyfisposIirumanttlePreecorded.

ww????=It 8smawondthaorusromYrelatives,mmufilthybcrowR)fAdenitwore0giftGoo x—awasubject)oBbruttyimerciPsPnwx orafs(poem,RFhouk) sːaalablealumployey siYdevicXofYzend{3,iexcept@A`t,HichRbey0omprehensi|agGStimHtstarvath.Ԗ!7prt_(umbew0T1arrʌtepmobe@EnglishousCom boactuhiaine-ths-ychiqqpЍii pcn̤!o8blah(d H@od(board nMfou*( Jf@㦀iejspiri{re8ڢQ.¬a$hupt,nc*ydyhPMeadXoff,diAfricѣitbsb$b ZP1{iff(w\&P100<pt="1em"> ππʪ@'ѳfuۅ*guZuåow,p@seafacircum(Ȏо(sishquar(aro`cri9moas`tak@purga coil3 mhwched!WWpubl( :Lear-cssoci|linKcondzt1.ɦnJkmodir:sixndrxӐ`!"platm8oid ķcbetweexRWsAtowidpNel򞂸!88dal #pmeYxpculpΣ2ti¥!p8lsr,aȭI׽dure808inȸznotvhs`josXeeI+xnrtX8inXȺI,icHputt\Ia.K4, ЄpacЊJngȔt1br8t#yyaPi101"AannisoffYasoreoomhonef`eselacks, erwayiwhichitnessfvbefၡBritishouCommonsescribedmiserablendojlaveshipboard.

ππP9102 ππhaddiordi`iskshipwr cߣpeculia2Ϲ Qxii-smnjsuigȿa#c dlinaʨ5negr0d@occureP2,@weྀQؔȾg@^Қouar(gQȝܠ$I_riwellwshXlogeIairpShe`n@s؇arkP gim跹xh`yfhav!p Q̢cfiQsoo؁zoC;fAliv9dea8Pbrief n3aon3lifouelޖ.fphcrevol`1759cauʫ:1happip1 0$"Perf ,sÕ3Шqla(غ tanѵhundLabomxhмkatJybo(halcrewin\H)u8*iccedu numb;(jailorܡgggc3gadem#.iiryowX?ckll mN,ig;urgeolp@!o4-boy.׻aupremk? boardedeighboringlaver,he "Spencer.sԀcaptainf@israftrudentlyeclinto :;Perfect,|andeducessubj@iongh;ut hadoilaughtenakblackstorange,owarpЅinPposiofirxithjguns.orbopanour+cheryontinued,pnchFPstilliva0;choone@shorplundeHburnir.


OOOO!1 ??97jupfy">How{insurHAs8downBtolpeara(hsa؏9officialmmunicaҊ}span>Page 104Pa105P 106 ππxw1 iu隈p»Zpeci@QalenacdttendZ]ømaPnsuScargexceeQhwyosmhPqiiusuXfiguѹAi5lʷnew(f`oamurHImidcaptoPi0c lpul"jettiso,thl8;dXy83easPAccor,1"pP8fRh1Xmpt(H|4aig(gr0)ihv((s 0]ShmstSouvi)mpduJcxأ덓\sxh:ϼϼϼ7Ͻ5 )o1uظrPRun8ablWu3bȈ#c5硯;crpu0`Cbjػ@-P;lxdiffic@yKJepruc¾ߔemcHi8. ap0suXpoQtiHoHGt€ȶUn(dӓڼA!o"^©겘abd.¼wrememb"aXrregؖs!pert82𪈜Qarzc((A0r*mdJ;ٴ Pc3m1:݃XWҾSev(۷0@o"OJ,lawbmsa h0immorмXrepugna8Psenzhumap@`b3fJabXsBDtarsuc,xRtHJ4aC)1macquiiaos@cepkidnPre􈠌alicuytXpleteuccess.

ππTheirsteriouslowoslave-trad0elln 1772,hennnglishourteclaredatymingand󂸅wayecamHree.ԁclos@aportsׄrspwoearsfterAm`ccolonists,ynnthresholdfBrevolgainXGreBritou putiaikee,dormysolvyou"notrchasewmY񆖍dXDecemb`next;whichim weipw 0discontinuَjneir`hncern@it se@8noX⇹re ЁPlmodities manufactu . ‹bissew0hhratifunablXoupۖ 6 Jeff0propPage 108ItasޢۜneAfКBbk74b0n. u؞StStrip\ Xg1Xtecsmur0٦Hffic.Ɩ0aj:Ġl}hurian0filioW;noLpcribIa@enzWRuXhoyQbouKpaidaptPY0Icent.OcHovoy򛀤recoӦ8o lad.ϜEnryorroHw: #9midd`passgrew8t p|.3;elinyCduparlinytiitoo ck رiPjqpublicY)8.ȒiHeopsaw 9ܨ0ttemp2regu@8biPȟƇMȜPootnhip stealжS—buhrY0eng(from[utiȇµȆipabolfad w9HL 稓C1ns; 1807xicip,y6ᶊsubj@ە)ThUmovX{lowlhividual-OolP@eж-qZX+pbsocas"mr+ҽ8efaaogey C`titPwhix8x˳:־ouHvigo>;couPdoQq@orȮAaxZm㾗9dol0aȶ¿ProؽhBbeI8^fow8araah=emZ8uwphyy`AmcXczry$𝥖inyigliHy. Aib٩troduc9MissppierPoϕ+2itpfulA͕ߤic,Xǽ聋@`Rdiscu0cahymea0`d(muɿuiHuplthy r&mdashdseHyonPa0110 ssured;Yyŵhr8ity;frexfromX8xilAfrnuMoreynXeloprܫharddIai𺵱iozdJmPnav{Loȡdeep.Ќ^cay)reincclPr#ٙظough fQك[udz醑non♑sei(—ea騹a?9Һiqa "XtjokxҺnӧp1820_eH -iru@h *Sodٶ,ҥ1lHs #_rightkܺ.

ππ

Ih蘂gٻptriPAchParliI1,vqreg@dmq8ocexcompletxI1huX!rktookeasacriflouxhLrpool穱AZiz;ngodihqsyWAIn s`xi:exclusboѰX aRhecdemQSpAsXquceX.@happil򮿮 ggH)Эhx iٷifJnpr`Gf Wr'admmt%Gn stubnlyrorefuQirpBacruisarзse0uuhX+zew `no-of-+9}coTt]StriplvirlAcapt J1842BGibox (Pk r squadrI4Ӽಣ @eHhoXhŗ0RnfȄ è穯Tv(jfacgrowR_ x)hincrfp. ɵ{awag p8sXeapݐjfricandearerthearketsnmer(.lave(cost $20ouldring $500Georgihiparry gowners`40,000,r re)plentyfenillYtoiskjpenaltie`firacyo`suchrodigiousYf.oreover,seaswarme"thdv ursailors—m8lPage 112

ππӜr'9texb,Hde(lilprh(1raȓh.ur}ڔh! hsel)gEڴshl踎an|lefyXninkswimqb7hMewchilЅƹgt struggwayry,eadol,150?wchjxHe耙way.___''__">I\I s`Hsynvictio gln penaltyl Hseizvessels.heursuersescuedomefdrowningegroes,hoerebleoestifyxatyadeenn*suspecthip,ndondemnati(followedcaptaislaver "Brillante{okohancsuchisaster.aughty8urruisy8e`calm,iddfrom`snemyAni ,utithIap)befodawn,(man-8alsetopmurd@aarg Rsy`mserhaps sAequi)Caligula.irst heavichoowucuttaaopeouldptb{`cwstretchІ󏚏JPa8114
; ju2">Aavorrick?9,leeBaإiﲩ 村h1'''#5'QUuityu^impelΥPXؼCtrugglth8-"at0SsplesʽuPXlegRSibhpeas㗡hildrhHч"olIfurnis{pab elkeepflnthjhe@;occasionо*yevadrif(8-ds.ɣ RKnav`ieۮ@pОŋ@ta譬iȬm;⹨iKevؕtbbk0ἲ۸rҬDQ3,uputraMoff1f`rhxo;ab؏hservengn,saex s[n@tеdoworE<@ h="1em"> ππ"TDAwai!gangs{ffulamҪRmewboy8iyougirlXNxJa[clo蛁(XmitaXgԎ!bopxincɨXs;bdisA.ԭath,q@rk1$Ix«day 'sskPquadswent(rorgbalt-wr
P117.8؝(h s鉭Ri0ɺIhorr`Hmagi@abo200e@뚈haP1l`5chȂҳx1!labodpxsleepur shohe8hl f 7bes! owh`DbelowrůcepowretchnTlayjacryspw,xnexѥXsՀwwo!ko  (afvmasJ p4᫪rem(p(siHXmxӰ nqhҕo!un@OXALfroʸXrZBŽovoAweaxi#`ɚahade(:basshwi -,18ҕʂhd~a՜arorQfruiytench8oconfx1,XtimxviolصnQboIp{2tal orpszbtpi!0DthxnɼtkԿ1exi꺓8ǖirЯ`rcapyrȬYlhelps.oo">Pg鲑alHعuI#xjc8oT̰scbenumbybyhAasCapPci]facȴx0x٪ccumuldnow(houptXZmin`fHawhiX媸aP,0meinkKs0ѓ4oook8oenix4t0ri.o·agrXldondžY0nAѽf٪X-1dЮ鈢ms.+lookbhaWnu]-1w m8aciXflif WQrvelooof somefheenngagednt3sarlierndoreawfulays,orgetting0atYirindsadoteopened,6yegardxnegroseve.fjfutusuper-refitat shouldtxb؆hfromll imaloPhapshistorymChicagoock-y8ibe!apppiЊDBighjBen@to-H, aArmourgiv8rex@ustrischool;seesuriou0o Hnexplbl@foundHFanueilȈhaveealhumalesh.

ππI,owrtI 'Amer0nr@ntailorponhnewishpyetD9S (dnrosecu`lxParkex9qu(tiP8dar@,ɂy(ship@acit(rac8izhimq taks;u brutɒȝ`ۆn҃ 0sepؐ)-tradake 0ticipatiؔɋYYIth)pleasenlaPa@I1untYћViv@Warl`>0fficollypoyAsP1860*yac"Wer@{`yENeworkفClub'shawbymb QCauspicad̩emostam[South,ȌXsПXp`fit0ar.Ωhrm`0seouɧohaaymPaivhfir8zoerxct8enh `PP 119CHAPTERVSseaI0i0}partNjYnlaydئcconomy@xh#ar lk󼨓Hbe l؞opoiaoadorn moelebookxain򛙺yldren.@deb9X1?GtpublY`ipqutet aru(illٟsfzX(on^Xefccup.Pa:ȺNh1)St0sʅrsuil3royP9OacronicllmY tgnpxXso <р,d, oQbrisipeopAwhom@)sXgXrarcآҀPeologists Page 122 ππScamRko98af8i I ȓopi@ؽ˫ontŠ0r!dEbeachCohLIshl`ordfulaw!owïpiec,s-t)Sfowwirl yclai0shiyt sh(sy 1650ٺernlhaegu:jishAq0so .ÞѸ+or(1Hoak@Aق|hDn[sb0ouXpʭipoonx1hugHyPi{bw8޾`c`u automiIad@ck8ideHdiff(melTmeth DxXfollKtmnset0ShamptopkgҰ[Ksity atinEn' ,XHtːurؿ0hfidu0cultivabIPwimunitboкfhfficгHenjowAʾb.עwༀihAYorkAboA1669൐amuelͱka(t[`ri tPiddurZinx4! )LittlSJ8oyevia؜:fu⾠seayndPоwrhy8eop/firo鈄fisyòperfecaP 124thertf "savingc whale—thats,ysecurXllvaluencarcass.ut2people9littpislandNantucketroughindustryotsighestevelopment, spreadowidelfamAmericanman.ndeedsradeXithilasirvessellyStarsRStripeqPeredBritishortȊ)aailorcraf8aahotic ecdote,owJclic,atold.ȍpPunhappi(deform"@whipoiverpool XehgQby (al@humpbackԎstation: Hello,ʁ`!גyouoBre?ܔsBunkxHill,4lne!LrespoxYae.Think*climbpEFo(sea,wepЈt01gHa Xnd-bP,Cs urfacsupgeC,Ssoprovٗ3se钀unfitn!maint gxultural.Ԋa새"Yn\erheaper(s)efXBoIllihoodromunwY,ookXaPlltop&umboce,4:iH as!our dren'!者8go p.$Wheɥ3rophecym no0v@,[eJRevohXAfln 360T8ܒny8}E, 1846, 735hiengagi4majp:hP:uiswtowardNjYJLso-crvarietyUcɓPhich0Adacomcibecaus>be2bonMng0nYsrom#ȯjawm pscsi iif9fIdigiouPp 125<а="1em"ph> ππ<0lign="j(ify">MipөrNewed @HlidaygasܮRQ!8pttм2p8urnaмI1ØVatcI!lwཨUm-㢉("irenث pvoyPmatsh.ӔIaPdHp(, kqblubcraicaskyy њBholЎQ`carbtckek Ӆhp—ploa fplodosrefacso`who;CHgoیضHfyh@uano@a Ц @rPfen l1o@ZAH[enHak Ž艑inuؿ"l`-IiBXɷ(noiJm2bjuȗ'ults` ynڿ89cpl`dndEngQsHn0B8ؒiAdiH1Shqҟ翸r϶iLondyho`ѡcpgJce777467aOckBp dire>skws, "courseickerlasketts,llom,opresdrumimheadna,hohhovellwindow-gHs.herad8asonductedthsameietyxate@anifesainRdirectionflave-shipsxprivateers.Ɂrd)oilyetchoȁce,Ivoyage℘peedy,captaimmendtoodۊ[Thee2plea0takC˅youXrhook@refull4Ybxwor!pday`yorЀxSabbathInfiedallinneoph`eet Sur*edRevoluz9fisheriesuffersev@frombBrit@ruisXwhen8ft(peac[decl001whaleganYingack,whi`y蔡oughtrvrvNantu`t,ewedf@LagP(w0gn"lAmcawxو@nbYlogqHirnglmarHH/@foundl!'nsen,sai istroohndawhono]Hremonx腍If1'brZ@s򙱣מdiaxlon[a`1uFatimKor:rs(else؝Ars.xlҥgrew鑇ԏ4midd؏+0ncXu0 ree-Xbbu titp˃Xvigor.ͪachusAten1ѬpuA,Htsoenqdinbm.y 1789btwPacc—d0lrea[chief@-gr!ʰ"otalytonnOI10,2 1611 y29nuH57880rperm:13,13Py127 t; jXify">B;iAaSn apXDeep-@scxg0h`XfзuPago.apxCstH1@ao`Naat|r1hrinAiffowgjJrP0y)ea.ȆtrIchool-%konbؼblubbXhom@IknoHcohb caloknown2 Cnum҈G眈yԏٌm!p0uRnob8um0facPwlyퟑappar0 beQdrivinacciȶ𯘽ⷝ`nhadiP…Iprey.͹ [qRhim( hxvalut+ acpr8IGn.rulaHfulȜfeed{bididneZtiȐjbeseem0i8"devгvictxpiY麓squidswPd il-y$IiA'ody3tom.u aXelopsꮐhqۓPQ?)P(lunl10sik ɓYeal})ercersru`hJѴkbjawصaurjrbot adepн200tPs;raӬem `lkaiohll뾁ll- i0acrpxӠoldCtoQ senbly2iil g!flupAȳbʭnch=assaibetwqca8n0syscriptionBBr耤'0pXxhж|ure,anyf Page 128 ππSuddenlymahgaveowl: 'Starnl—s!h, z!'ndoars`likeanessbeyed _____^A OOIGju8fy">Not qukړ1-Z0kbo~har ouphmaخ@Wmytb˲to`ĵ{fiP!"u9cc8DA Essex,밡Npuckeh*ttap+sunka-s>P 130 ππMlprombseemaniyis ,J hadot0purs@`"Essex,chougherhapsso@limeetlfelؑXharpoQx@chaPX 1310ot-2BonP,BnPFarall Is0hHtaAῠanJ1l"tayj-to,zP 132 ππT@toolsbusinofuntU 0pursuapsimpevenude.team,tahauccee`sailsKexplosives8veisplacXwyXmypooneroraunchmdeadshafts;RinmaLtmon)scond(w wixtyea8ago,IommarrDrestmbiYaewnglcoastboy. AseQ usualbrigrarkhoccassch*(rangqfrom 1005:nsy)arictecturdunəu(asparrycapacityfurrpeciZheavyimbabo(jɝpstPage 133
ππHarpoonlance8reptr؄RaazPedg,ropellb9eigosuscl@rawnySsunk is@`ghpaperyxBs@lubbȔXэ.eyosrimitppliknishnegressyarRirue˖lzday rAh3,xplosseplac4phipseXJmsfittCuxaateam-poKPa135P 137 ππ0yAneopdurqvexUs8y—RevoluђSWaB1812sCivilف̗:douCfroq@epred(Iۙonfeat)!?lYflictȎafurecoedatuӢ𐰬mAiЬarvulآ꧝X.æ̇tca`alwa0ShomXynthoftڦyɡclaouaph(@ynitris)apoleonicˁcou9ewheRflagУ(əqpeaksyarm ouҘKipod жfr(ѝDb󖙶"Engl$y2objectfenemy's9aon.ƓelhtgrogZmarhviewB)japhens .ађxrdȿgrow ˽1пNaiPrHatЦeal Jalu%$8sur؃(Y#on9olaian@AcYطLqopporttfd a-.׵ҫHfavo(-undcapdÿXhcyH0regap̸zulcɳȵ@arf@suœihxVgaռ[oic:Hvܒm-of-agXk1nr- ϧ8pthPbuilqp71\exp.ͪ{>Hpȩ s7774871bHhYbua "1775ntuckePed"150䬁gg[15,000nI!pu𸟽hk!p@ysudpX{Edm@urkmeulogylloBeloquȧIedH*CP. "Nep Qan[Hh,S )ainrvity F, dexоiirmgac|Qy,carpixihynFhwhi1te +RppeopLBuTÌnolۜ6لY paxPyp[8t茠Revolu %T1N0Bed) ippYvsdy౳runniriggHtaiI }barkbҏcHtr趒woѢrude@chex+iyл80utbreak6hhl04rzmil, 85߿pht-+ 7+pb.

ππenP酘naryaysasotasilyorgottenyhehalemen,ndiriscon(tcomplainingerereat؂8!nationZagHmbroiled hwarithǁBrit!81812.tan*beai9cattitudeQear8ofK`flic`patriotic.heyaduffd—boh ndRFrance*Englhtwrohichighellouseresh0th0AinualimpHs,9shipseizpAmeriirsyal @ egviol܉erdiCouncizsPdanifesto;uÐmoeagerpeace,vђIidhp0lsuoEuropn,P 139 ππHalfuHllow!du2whic Iind`r ah;*g(hȗtCivil׽lloi댚񷹽40m=onfruih"Sxoah!burXrty-fX$m.Ʃ#(latrokˈ,feebY؟dzchieroducth)lengп`s1growcarcںhnPcoTo-d Aold-tim)aзإ2pra.Hrid9Qsala uship(0mud-bankr Srx1ewſowhAamb30׳gozqaaغK8'a(SpaHqu@er-hkPgo¼`c,makחٷn lroۡixpQ0sHc:doӢP@d1buffWer؛aref="$00046imgQpex="7"أROTTOLDERINGHARVES"itl8oool/#br/>)o7ooiW9 enf-uPacih1beg8:2 0;erynisu`𾯺ؘBedxseloulЁu蹛g txeeayXryr 譡hopڛ,Z릡ha`Perhaps thereouldeoousitHtomepecialntpstH ruise.radesmenfozXsortsuppliedtoha(.mbitipoyf h(famioughtlacbef(:mast, xasniggoyHhfulდnHanommandwhaler.ofrequentlyxcapta+goirec(romdrriageltahip,aking(@bride0fIa`neymoreeearsea.f8urhicond2seatby؃almounivers0culinemploytcurٍ1towpopulw(n,hildrQtalkst@8xbigtchq!priyhoi bHcB@hdarlors,h-shellcoralÒ)trophPacificlQxe@rna1dista`husb s erilyavedȅy tex){solisquH+9builu!timb8d *Ymselv!Hfocea,beir ge-polXail0m8l"JBncwДxXlook0r !hcannBbrizpG.uckȌdyf`9oarff-ɢxflag ig⍸@profi ԇ a耱JdaИga{New̛Xpord tM"Pxeer,seeen-months't1864-5.Ӌbback 1391Prre 22,650uaȜ8llalut $150,060Envoy膱Bed8fx emn#unwhy8A47أy$8000sѧ P142jyo@.

ππWԗjcrossy irhbɤؼrkXgahRudy iph0Pa0rXrОHow2S FZHelft bPѵpl @nuw-Qac9joarankP1dsih1ijğH.Ϲk*i2Z o!bRkq񼈍 tuIlȃ!Ysuٽ(跀*`mPbP)grownpPgekserXtsAcrk2ruȿLecʷvagѝabȶP0Y advu @spiʩ0xibe񄓵ne s4hcr. ndianplحX0hysiq8acitȵrmkillfulpo@bryne3H2ٖž ππAsulejvoyagXoPacifichwatɅrou`Capeorn,occasionalPaeladety0twardzedxGoodpe.lmostsldcircumnavigdeforeeturn.nPrd݆alAfZiramHnlentlo1cox)Chili;( ixyec1oushurYenontilJapaneaBerybecifavoritishpla''''' T)qbusufirs񊹍ȗplook crow'st0Xrm-b aanimal,╈twilungs[notgilllikep1isbco surfPI odicP1shoesxYexafromx"0 w-hoQorpiracaCtophead;2Irm,oiir,thuoiincoolunsepae:vap`q͜taiwI,iPno. "(sows!-l-orlbȁ{iܐhspectlivi nneck3cap@l:]xJdir:83podYchh. rm4whb[ !gl8inst Py144
??<ǯapproacꐇ`yf9B5ɭup񍰩poil(t ngT)deȾpart`my`vis ,_medjdefA)se8at1n@enIpwhic)gac0was)ahon)d`aڶXwea(ipflukYwpyirresb8pګȶثɹȣrsword-plH(ɭk-Jidwe9jawsowɂZopbo`H\el03hqӨO 0 digiup--downhޅDgarn[shacgulle؄rqcouldp aȣٚXeerror|eyQtoo(bliquely8naୀXsea8Za[iaccxԚ>j:🧪3B̭Xyvppunitѵ9 HBig(C뻨noluggX. pmainkZZsY ` !sound,{by@noZccShf,q8exHtak )r،ȔFsu8gvziq̶Sy8eaheesafh͖qo sعع+Ъkn0agȫȹr\d!,f;AQr0sfolHsyP񣀺ecobɱoa9.ӱ 9HsustrengA ski#]hurirb fou0rșfaPmfamH`AmeriBritishhiperenursuitfheamehale,Britiboa n"inside.tslaw fperyhjelongpo:zfirstakesast—and
Page 146 ߆߆نjustify">W!awilloentruckoЋp8tebexeJev.ԕl-load)puff,erspirmwho@vellXـPpeupmo0`mayuddenlyxmselvHconf8fur,ictivaggress`Ҝ(h8`bpgdirpowder;r([impHtur ailBrun metimound0god7ntPin"xexhaedÁ[ngor⟳Adra!7IreappQwaiȈ72xoffsurfaDwa)fiftekno(outoC18hiqcrew0p{NantelA-r˘[yosӰ(oBa񰫱tIxIc a:omqʰ,뇱lpluxtW hcarc,ch<Კk ierhhr sqmf,;٭@mpaiX/rollQrab!vullyH"c@YiIq,q"m crurgulfQPfi (hifL¨Wpath-okڴlrI٦dayexphombisc0gm)iSPdPy il;⽀palmy+%fihAYIoulshcirseaP foamz!LBbox(spuar:Qfo sm7razor-ed돒p(snTlHb8sXsucc!(1roacb#C(3com` Pipll;IlacidsmobXeȊlǹ$.پ׾׾ѿStoriDfQ)sfni蒲 portyɾ brmXcHCapnȷX"1ReaЙaJc0uXascinabookINimro!Sea.1fir+ɢmtough3arri"ib9wozdٳbwwimmxk<possibHϵѨb蟡ìyc#ZucoH wo)k???<8?imeanK<iopani.hex⤄,den2blͿiѥnXذ0Ar!uggzTwy&md;twelHrP.P0mol9i.ϳJvnjlef@igqla0nᡒm8ʶxThreailomb1,a`Cmy,arpoonroq8иҨw㾠ifonescap!P-jawlourx HNowmpick upPcaut cuby(cҏķ'᛽isshuxrfhireonsterastillndaunted.houghixarpo`ereunkntoisodyndeBdragging 300athomsfine,-kinightqmood,runchoars,eg0bit:boatorXenemies `demolish.@hsadejtship,hCaptaH``,uite oggeddemxsbadversary@prepara`r`wJcombatwoefitusaga!whalemenparAafire.Ȋ(كt,mXo#tle-grohmiddébrhirs'`opertЄwa8ttack.a;9chura ithrmy lmovswar8oeetيArea(jao犐ma:H-0, h0eIaeefxtes(rush;ɋhenxplosivmb'sital0h1rIpasXStruckJ,gtuw!flurry;؀yollQ8[Clik(valaHdestroi(spllJhathreeXrSXw,apavyXӁhoronicYtz1 Page 149
ππCurious؏ 2oPeРlratuծl8r)decxold-tim䳩lp lPcXinuaohn񬉹4c8omplaM"Hqwk0mu8Sdisuggp%*8ld ˰logbooyioBtempgraphicqcription.QРieнPNHp@8ul2inco(Vloymn-Icʶ`oubtsucc$ȺѾPffЛ@golger&mdahimfwitooinppst:є\cXer"tab1order="0"㞐padـcsumm="TistBr>length;̂">V񾡰Xphbodvٿa)__BeyIce2unmea@ytrXbr/,gg>WBurfQTse(Proke75ArisQ.darkbyPbep HhppearsofQamAsmȏggyircwalike(bankzsnowGGGAfVdoassߔyp8`8nxieeGHuoura3esp@pP2R7ٶǷǶ>Stor8GAfis P`p(PulSly [hbesoeffgȪPage 150<pight="1em"> ππ "QDutPp 'G-Mool'mhColiusǤOuwekaasiȥarg`nXsnchoǤn(P4y 1660ϡperceha Hhehis,ck8tdan3ڣkfirs'ド)eȫ`vaGhl.acquPVienke˭3,o`Dofwnp@maƦa@ԍhxPshremou surfaAas0ۮhnX,Po@cularbAsod8ciblip鱠뵜piecPO Page 151<ight="1em"> ππ "Cy,m'RaH,'LeY񻠨se UerPLabpo`,ͶXs1802 ಀY򪤊HѻȒҖO .ouūBpat`$two<0ucceedsuqsltopѳ* tiȀyam@n fishescendedewathomsnheirectionfnorYboats,hichas 0advance,ospccidentallyenet,truckXihisead,8drh5,enapparatusboutifteenetair.ɂinvertbyok)fellHtoZwatbitseelpward.HypeoplXer`ickuplivx fourPage 152 ππ "In 1822wo@longiship 'Baffin'Hpursu@ale.ohnarXharpcomdmsҗyyh) aa`shoalIappeciesysoumeroth0irlowᔛcessan [ievid eehundrQFearfualarmikany, remai@i`mol8tIprj'J!pproach񡸟 Pmselfً딀t.h8zG;pass@apidlhjer!l aplacer up\gunwIruЧxavorabposiBcar1VdQ(uQ qۦpbeg8fh@legencyrav@8se09oHlea&tor!v;`someircumsh@n@ccounhuZfl@,agg ،ʱآp inQlw2ˬ,mis`SoudtyHKH8aw٫9в;AwFrye immediigxalf 衂2hoc,loo )inqubefHimsiɎ9ma`Ⱦp*aw񎐉 unexp3i+bqtuleffrDanedXᱛvcit[ifir`cҀrom)؋iG8rconNoP򜓵d̠jlСedgx t2ba@tz$obnrunnJWerv@betw꺁eOb)disarڌ{xceeddr{impIQݘiׇҜ݅ 腠l0:deep @0Z8tlamaa½@sPY9o񊘉8 q+јPck"Ay "mк;s8cuafig1PPage 153 ππ "A!t9caeirPܼli ve19ed`p02.]˽*m0y㺔ȗ?,4fеkJlSme ccurr#csuampQaXaid nD*YsuXqudutiesnarPexhaXllowmmapminutunmX{tXavbrdegrergy0advippPìbtwayexer㳡)pruits;)wiP iqlp.ggg//ggg@bn 'Henrietta,'WhitbؼzenghaYa(ꥄ0usY3aݻcaatKXbD0ulJL;aX +whbhapѺhok:9¼duc|NdownwarHbegȔuZO  innnstantaughtimyurnoundsody.eadutustimeoryut, 'Clearwayheine!h,!'hen waslmo(cpasHer8raggedverboard,(deeafterw.ԃr:h(momenxIwithvailfishsced aonsiablehpthdiefromce邘Hwn9surfaЇonnecthQsecured."

Whng eashaveplIopliPofrationaldries.tsmplerelicsld-Zcruisfillich88museumsemorial„practicallyxtincQl1.9wharv0NewedfordҀLondophrigs(otg[soffiXbjg9scarceanЖo!greXfleeurvqxinvddik@lЃdrXn晠inlArgXs,rs匈oyqAmodnsportsmanlikavicsteamexs8followym`Antyofit.ŸxigloACZRegone, vrdP 154CHAPTERPage 156 ππOu8diti@ x8j Napoleoniclagu orc8worldpru蟩practis^Ј;HiМсpurpokthbooktelltបAiHn񂸖b lPɔuhr❠f,'$Gman.ornd,woßxroug*iderabxpo frPr؜hт[n! Ɋ„nhcrQ ded.ɂPcolh0yli0day&naIam'؅ov a8fa.,meʟȃXxtu)Sήmopemز<ԋjqpr( Yf)mўC8ew5old,NE§`irigjmQleghzycynafalltѶfixJЮ tq-1𼟼7dead;y"agree ,iUnitSt dConXsPprefusS:iж@lawry;BqzSpX8pboixqxe0xbaҾslikeP¹uʶ!wivissparwi`tempqggack;r+qtiteѫ2oȏK4t@lhq#fXuXsea.ЁĂghp0`pxiSCh(tomwhyp8encX(Ja′tk@సobjرl`afflsd0erhaphkrgaqzne8ovffic @{m؇lpA:caphelȗ@Grmehٚ a0s pHrQ, y qw18seyaledie!fare.

ππXc,Ƕqeapєk|(pqaar8@Shh!rHdow g8tеGreBhl9fiH Revoluagovernut9Yѿrr(ishW\enjoyexi½@ |HuliBdp8SevY s'ayqu@umb؎"鮰'rJrhaeataccoB*eӥx8. нPers=`y`y@-spЎdy)_^wh`QobedUox xy`!eaȠ򰳅m љءˡŲ:c9yԼ 1.ow 8p`[ru GsmKOOOK8Oya "ruluckɡHw0psrAh)Maclayo Ho AicZteers"shehiefuthoritynsubject.essertyat itrequentlyappenedeve#commxsailorseceiv0airharenHruise,vern8bXTwages@Husdollaxmdash;amallortuxseaysariner,)fur0rt;iofboRe 'Rang'hoesnonthee`dftxfarm,hR`Hsugar,omir(toBy熘onsfoY-proJamaicausom@w`youndcot,]uta`quantjfiogwoodllspicpbesidehr@܍ُey.To8r@rdonjoiiXlika mriskperilbattl"additioڈea;PauripPctRognizHhbrancXindustry@۔bxxЈnotethfowix!wh`hmghqf2qȗcrowded.nivlifa-HosДjᄬxAwhich9rulmi8paid.

ππVerypeedip rivatqbec pIictsigYXoQwrqAtlAc@ties.hi`difi c8thipowiaq8eѧDdeFlybynum (ntp[obdemean8RgXz`jychu,HtxkifaI㬈.!eaAQ9u)bacЈpockefuPeas-w؟r隑ll@biqeek@eah wّctacu3rejoic.Ա: 8ieؗXtastedexamp(r񷑇IsѫHfamilHЈXP 159QuenougxAiunxrs@ocrac٥aviɋma@anʿaygbYIoiK Ы9(ۊ\|craՑsocistحItrxӽ@hg@ڂYunusupgesuД8dْUdrudworkʣytfcW^moomtabrdPaduexceptӪ(ht#d,@rfЍaun2a(00dȾuɿen-of-warȯsa yp2advpu*soh$influenceooo77oohIt踰becla`dwr`Z3Revolu*1IaNewng@v~:youbȕ di0ribuشxIga@ค1truggle.†HPsw, 0Paڹnb;!=ɾavzA0iٿǘHovinsuctupirty-the;BP refusaltogeI 蒨0@zɮtory.Ц, qgservicX1qrPzrظ)engditIH5t`ell1yf` i0)irylit(j(Kvelsoldi!ۼx-@lB(chwipicesqumbishؑXI Y.࿸sulXXbe hX1pi@`paX1rm.ahngt Bun󥙰LhesRkldzcl]}s1VyorXډrblood P` 160 ππIpnithdmihݔ cyetfkmvalu1@IecounodavnosA@ollow Yod)ȓF~ima@りRevolub.u:C#sncurrФ6sellpuXweopl8iournPowiffon9 psubjȌop؇discussMravagConfR/w`loyBshV@dayB">Aqypa7bCaptilTalbotf͚0husett0Hhwa@appicqarh,XvJʳ`abin-bowrq"cquimerofx8x8 D1(g„!hsailbbrokШ9lX yabHL`QProvid1"enlisyP 161x#iggatshhaoFpublic жcwork?辁reasl䧱خ$xpensXAxsultQXes0hЌ@nam@XDec,п`e@HoppPrebBarr1XneXls9g齢Px–firstlo clYqharbHsrȫ𕼲ٻ8e- .g}AxcamHHLEù"THudiac1fka挙lo`ٲ b)`drodᵚb`menemy!lee "Asia.[0oughXickotargxׂbathheȻ3 h8cBfails aЇWQ,T.f ̸hcanXcrabHnrosP)ЭrS0apؐ|!䪲ӵ yȻѣscarceePiracongra yZmpYs caydaybaXnu:pllittloKʭبrTedroyed;,ʳnAhoounsafȆږgdbay; ؕAad.n 1779տ)gPnsloopUrgo100ns;L2shal,hclumsylbans0bbixap`ixtyGmo whAf裂himcrews1H̷sdundforyrivateers;orheoyalistsneworkereuitesvidspoilsځqEnglandevolutiona.nisecocruise xtookvenqzes,cludingwoahoqew 300-tonhip,astlyuperio"ArgoS!armament numbx,jybattl%fiercne.arЊHmanquarter-deck샿kille`rounded;speakrumpet9Talbot'sهpRdy*bu`taannon-ball`rri@awa`ailycoat.ԏdamageusnȏtsprepairwhanorritishph@{3gP 163
D ϊϊɊjhify">2Hun1`lxbo8,o)opns3it,ȰaPreaHa-rolsPHhjpleas.assachusetسϩleftoPempora(acccsuffngs+mse8mrad@philialul(ybdensp@0owom=@rQfadrsfⳓ@77777aref="$ 23PRISpSHIPEERSEY.FgggcȬ߂߂ߺw?wwuAboue-8YivPm@i:w(haesePerB! P0E p󪈷2@veyk,*vorigda 74-gu'''#4'Q0ndow(ҾmooBWBН!IianeixertplaȶLs9qre,wJ=BrHly(rrh. ILmya, ath lle moretchdisgobjpsqbehe humҾIsmoкhhٓ1rafi,is`i$XemaciPhungnxietyc(9htr*jppeara@. #dJ @obHoddoms(z!P)Hc`9ipE eHmuXjlɕtarinavy.uiPfXKsЂws:nӳHax𳲳0biscuAస(ais;ͮ`WWWmhStwo pc؃ur;uesDŽDŽƅzsftc.3ɵѴ荙8gqupt[proH(eYher,ywhakept*table;YI蝰 K+dam(d i{heRzfhHK'eudpmh0{hHxhibаZonsistencKvag"fyxa,fle`5orpo -hog]inha0aoceXrھtAɱӶ@ditigrape`ɓj@—noӈadhesptioXge0achװiddledyheormssoosellirttractionfohes`,ehouldotavensideritXrablxddiouriands.ԃflatmealr@, suetigh\beensho0length9!ship.animesincehI
Page 165eleAs."

ππSudejf헯gLRevoha芹 squcruelj蚜untuni!affecQ`:o`hgɁ Pc1775-76xcommissH136ess:z0ns; 7, 73/73%68, 115aPtal_Y96725051780, 228234211, 449b6735 (jP-wHHark): 2, 32;484;ѰYH iciency,tow1Qؿ`fXXll-equiar-~reax Pooxccemȏ Britishigxhv`engɲXbZ$бiz)@harh "s`evncBao轰֜aIdno!ekvapy1emy'ЪdceTKusinc(rsP1arnofitȶjerch`hoJIiѵ)i0`preybinfefen.£piȑrڊo]emkXItooٽhsa[/@ ep)avoraboddԻ`هyxlYyn-ofrg8"0lung)llngp9Pwoebdpc wo؍q eclHouC8on$lo8 o0icaamsJh`ɖirty-threhipsaaluz $11,000!@HMa𑰶mژ:@,ya8d`(ȁeach,떘)so Pw؟òh€-gHishNȈ/istakXcaptu).ׄJ蹉plX1X@p_Xobtain˜⦐elihQ`轘sxreco0m9ed,𶿉drp"X18Zputorth,ftll,nderherotection
Page 167 ππThfollowdulimٍmen.o`Kmenp(irdinarvocaAsYsea؊re—becapeacefulailor(fisrship-buil(a(oncgaiButsoaohhod쌘dw@hand*؀x9feɕ@O comؔaTnjtnevitablh8!houldeany(rpunKo|umdrumfbhonePindryh1driftᕁJx!ro`9Poutlawry,䒁={tic8ShijBpirymh0buccany,urs+edato0.Ɯ0aichruuptwe@EnglFrseemmiPH1urbul8iritsgeniPoccupRH+iPHr袉ed,0 1CitPnǑ pUniaStakdvsuppos:(tudAiopair!Revolu"fs#o our𬈌pjopeڨB.t0admiHXswrP`0ask,ɛPbCckwit0Hveats!e0ncymX(Y)o!tlquఉ vxXOFrenXflagѷ^iwvidyȠ assfmmu`yn`t@xsecb.n fll mx닟X y husiasmǒciT۽wwws8wк)ymhaͬ,xYselv!throf{yo9fewg8Mi0beнHW`t4ar@Chinfwuneul(ckHbeg0gzalm!Qyolʇcris雀,(ܨ(XctupQU.`Dea0Ba؋8۠!ѡma`aigotD@l~؏h!rwosailo]prпX±ho8jec ڼa) HmoQI+(xoQF@aؠReiRepublbhHGj(`breefmaco}Ynot eat(^YQsger'8 zss!/#msta]al d0h0XBn tep Ы!InyPrgc`odʿ, i!q`.׽Oxgar/2࣏hadXиҮrig`leyhȟ tbl9َiQRJim 82yoeJeffˉceaIal;f `Jviol4/whi8sou1ay `݄ 䘘{byǘq"8ڟ Gi𧈛;,vparpiquca`ɡrefusPhaؕQem#':0___[9_lgч ag؟ڦ!yelpupmqÝ0t6+Pm.ϩ werehereyfothrancendngl@;utiwneutral,right fittingprivateersourwnaseniedshippintpsts.׃grou(betweenJuppernerillstones.

ππBut, 0sothans, secutionrspiritzcreweaponsortsorrecهhxaf"thatverymericanessel"ossibloilqanyhench (aish(uis(sPmR؋;ӌGonmenimpotoXctBsea nei2鐌ity{sؒד!porxiPhiѐSsay@mm؊쐐pєAtwo(lntȖ!Yankex8chabmeeituaZbИQy .Ԁadi@otivٙYirfiworld'Prade—nњmoxroced8. Ȅ#builzp b9ohX(ruwfromith4z;Jannarmmf*i)p1bechXcXary.oG,uaong,arp,ler-crafIpldowrhalmohafloa8moderAd9q̂{PoXgo1baysporfollowmșwelgu2arr8orifle{la؃ȩ˂xl9ia dlAcdly,qdedB:xnsu(Њ)XborneۋP@i tʖ`onpPun8)EuropeXwzY(yٍjnmbarg@kepC0hohaailed`arcla ޴A :Hnticboards$Page 170 ππ`ם(膩wonfP,%aXI{ HڿIbeginn m1of@ecopƠh attimaniTZictoNOrl joinflueupXulX๓jyt0qeaRsXtǯt0ϻqhonxakh_0sm)bإ$f+d)navYprogsꂉ忴`tyh0Iguloop, licspusefulΘsenBը_unnvo0v+8toݾf`escadrucۓ-aibroad곯3zusuБ115i120 e=r-k, 31beamgiȺc®alwayasrvtabYcl1$wind.׋ҵ,feqe,)aדox{putwn1(beaaptH2to 19ȰɝYm臈AccoryIaƥ-d(a]XpalAN)sp񚘼Hx`umPY8admi^enh!oi`Kod¦$0c triedotilizehemorruisershenaptured,utestroyheirangualitiesylter#rignd eng8nhullstxpensefightnesymmetry.

ππIaveHreadyefer yMichaelcott'samousoryseafe, "TomÇqlepLog,ÉP,oughnmorkfiction,ontain oanccountsIact؅xpPs,bXrf(yideayBrshavofer닉im Zityelle`ot؅ohi icXrer. xaf`withxlivecripbankeerivateer,ysCswass hiSextmd.eГXehpundwq,admiQmodelapsparHcordag!8Qswif2ZRcamboXch;windwar#thbhang2΂0fit`sd:///WW">+WQdasmobeittlHrȠop iggГev➺yp)or; Adock`*QcarrfairbedevilHlaȕncw.irsyjreplac PgunwaHheavyolidxlkoureet09surP mmnett'anfoyÒzP 172Mor×nicle1814????/???9T whooaIrel,Wex(CéȸoprHkfergu(shlavɷxan(+unresX8do"few y-by-nMbl8d iڻYUniShPJgrievBl01lb!gr@5Thw)mul֥asant8on apta0Boylܛ kCha`ur,0Bximoclir,Hsixnq(om(mAhrfficжhea+ma1OJexha 0ehiЇossibix훉ndexc¾profiyAEnglchannelfavauis-gB.ϋoj"QmbHPa0nem"l1ܡV k)awh8a ̗$Ifleetoma(dJeffect؝waea#܏m*issu鋈clam۲RؑII ʲP8ɝ%ndrawojk(llair飙cuany8utuwhi`mrЗ1thxerɹ(p8swб1s%erdiczXlawYde8ab(iRt@mx.º5A0sK X Page 173 ππIhtime,o(-AnnegirHcord0"a틠(rArefl!onҍnavyIathousjhipsommiss,Tdasafeaishessesailrout8nvoXromRpa EnglِIr!Cxn+a.Merc`heldeet8insurar(board trime(i`3eovernmnsubjXowner{mlasgowresolu,(4attDty`Llhspa艑wy-fournthbP`undrC@abeePHu١`w`xmamtrengwehimpolyntempt deeə@ǏuIsle!irregulapigmym1~yo і𧒠fhado(hhn.Ԩhtnenryam1<)p9 gany)pleP@rd!icoas1814(it*!s:r77">'Si,'schorn 200ɡ2sevguLz٫ax,zБage May'sur 'Lr@ٲEacro)seadiXtc'ۗ4fXomews0zڰ1Ȗ,x way3vic0yrekabllĿ*Hy0ifHn9hyqJu12 Px 174Mamm-߿@t4ǣAdayCapel,hnmHiЏǵSmhievYllBPrлNeufchât'workhic*ܬfavhauweu+suQrabzrafmpX.˷ggv__onenuHyr.sHpno0aPc ܾ8BoWa2;eh8w0XexamiirAx9thرpo tQlaXBea(mdash;0@uuggpxG lifdC!pȅpi頺zXteoCoih`ceB KaɔXopd c r8СeXbookit.Մ8iG@sralprofi;pur2 ljassoci(lyIhaƹp0.ha!)nteace,ndtayehtherenchememberedw0inhiweaduppressCitizenenet.tyat`ȀXefujoetoggeshallakishiputfjharbor Page 175 ππTMamm81empicauckyZ.nYweekPook8nerth,aj8Ўlfra s r.ncouivpattatranspBhund bprudw(f.ru ǃndapnuО-f`ollar@`s@rs;jgoR.ƃ򥂚s@oueis,y ldroHareleap(mʤІˎǎcaptu򆫣 vil n5~''''' Of2IgoYPdeeufcháteljmostamouSBnmaphrodibP310n(17*å`_es v8 ngin!,ofX`wgoodsYt $3,000"@sidвqu@peciH`XtoricchiKhowabe Endymion,qNheصdark὘ftP;co@rn˞na(Eanبذ8A褸wrote:SoXmi effecta@saidrXy`͙:aA .l~ฉowy۲+rȋs Pa8176Page 177 ߃߃߃߃P justify">ȸ"Prieufch&aac; ?asЖ oasuddЁllcarĩ*(Y#lpa.">AKwarog0beca@*X(`5merch Cleetconvoy[a-of-yhmұ@rseuldopy`nations yiPP`-*'h8fetcpzruisei9pa0w, hhcho쳨Lz g8er.׽jeni(؆,iCeapreyBus+upͦclum3 xselTmakXailz,jP rupoiQrI#@ræGbeg (frb ۄt`iqdsҸ icobserv wwǫ??>Bѐڹ0on%vggCȽ88runnTy8(XPdefmس scornwa8PrJge⠘p@ XoI9whoȦ`go)ooaluabНdeHl+_/fdʢte`on8IirmQoɿarigC bXeۋÝcrewlughAime0desp؃8f)Yankel0lcAc IbesiP`֊jijbr:sumXciG(9owasheausefnnoyanceoenemyisproportionatevenirreataluŀcaptors,or)yotnlyxrriedRlail,uteresualHagenciesyhichatch!British Pp 179
ππIary(iversmafevoluZ days@ous ptuȐnimaellrexntypical'cerimgcindex="00056""IHINKHESEAVYxIP."itl"/>
AfoglearXuperceivheaarship EnglacollwX,蔸ingthpurow. 0smxupo(appӠ`aty-@r;ⅰderespectI Kitf0sathaw!8ldastN,1100nPufitQolerAmarqhemradm@1witirtwoun!furn%ahmplem(Qone`yifty .ӆTl4'AdmiDuff,'ah(RSngIp.hri@piAEPachia,8sugar80tobaccoboondoxInzfirlieutenant,r.̌lho-mexaminSroezhpspy-glaswhHCpainilleɬask@op@Hp .Զ/ Qeya!okdelib඘lsilɧxq: 'I1nkpa@avy*shavo؏f#gamerۭhYa@igp;fwou keepaؠhXshobbdsidddoes;rRЗ rn;dva3euickا`ge`longbb.'ϥpɏo`|hoɃ*[ݣa``/////=іT 'tpmut-us{Iqssoe x鑄cZd@uoffiscȬIicuЬPnxwayble-!g-laYco yȂ1-trump("^[ossepo`fuloKdirqailO@tYti)ZermH@] 8ady*ɺflaQqAmerica`QtaU¶QJn7pelevй0,claȣQHullo.רcyou?''F)JHabnsߚߚߛߚ߃Wq'?' 2ϳ矯;ffˇ yǢǢǣǢǢǔ6ou@@ur@o@roY$jIzY,* ,Pi=EaxpredYe0hrPy181
"Theomplimentaseturnednformfullroadside,ndactionA(ced.ɂRstaɂXYedgeYquarter-deck,oponlsix-pounder;XisosibgaveinpportunityZeewhol.…serpxchadithreatapid9early@ou (rق!fwarhscerta`d,rodu@rib(slauerm@{nemy,0i0los 8yetriflinghappoeokЅ:aotojm` whenlarshotathroship'killmidmaA)lafro!fmarsc錑eelr, *lace@beidiateXsup`)sxɗ `ussuchannsڄgrowsprit䎐ctAcr 2oastle.Ήknowycaus<0Ϩ ϩqnnewѢJadfury;wconu unabvigo@soZ1eaophmuzzlralmoخHY8Bhgp
Pa182 ππ<lign="justify">Butostotablef l8battlesouyrivateers 9War1812,asdefenszZrig Gralrmstrong,}harb@Fayal,ASepber,94.ԌfamousmPsassinstory,nlyecaug@af adyʇ>,ňthreeritish -of-wsverZiropop0tePackenham HNewrleans,ldu0oinjuriPyeceived,CmoaiHexpedonmhthrntriuJson'Huccess.ߔߔ">TאאАhadsauckyraftherloitscaptuf@rch`8 9bar1Ђ9xm@giv S!9swhiencourywpreculi(蘎navy.tver1ginn@wh QCa@Guy.Òpli1avf(fxmo houЦxlic8hrQdamQhappy le@Xsliaiwifrened.ϩo8ccasx⪃.armvast`su th,УcSnXRP184dtonF0c@fipƵbs.ͬfoʾZa0oyАZGh,XseTϭpX"W( 0osplagshuPfhͧ鲰likesitTۑ/////(A!clן)|$rap1Qe twAthX0eltnf{?oh6.ȢaYyisc߶panHIq74-inPlantnetݽ38 Rota[Car}ag8whie(ul hop0o@victorxTIH:k!mqemXcȴQboats2wom8~slPtP5 ππIts oote,af0l+fouxqUcomXdcalmHconsiossibHequenceshviol{\neutrxtyipempmake@ppeaڒ 'iselv0w1aggorXHleasxdxn1ormalporadmixty(h"H sentroatoiscؑXrac72 Ѕ;2hail be1d;ysuffs8l͍ccord0fel$affrotflagXulqPbxpiby/V3Ӂxlağ3u,~,lse pP+cknodgJ뢱hfectɤantWstA*as(؀cpoxoqvilʄ:memari(777770ydrawЬl5gaXCapta(Reid Pa186!g/gg2owaridn{ڱucrЕir(bѸkeJ9eo=tow8whrowdXd[cPnǺrhicy,8cla˿Yl߹ظHFay0cW۔. sup@ɿ\YWGrmong.á8owؿ HAncҭrassista.ɽlsoؼ2hQsecoЎwGGGD7GqKwL`mostmDiitzmoubowusartill`0ycrafЎAProachulixdtambeX#myQ@rdheasy-Y(yynnolܩinjuPI2urrmfear73fy# Βugg )a9pвpoAfairsurrd|,|ivPqckt Ѽ.uAoutnumyxab8m`յK굨succee}Θ8u4؈Ate-quQ0an`u`ȢVagqpwfzfdCde!dy!cАx|ehvivoleap1oЕkwimmazQre)wk xʫXi^@=k*clnщcn, iipRle`0ঁKuyss0Mandis|cALomXhichadeenheainstayfdefense,asapsized.aptPeidndisficersorkedithutmostnergy8rougnight,ryingoitBvesselorwalcombat orn,ut ee'clock llashoreynoteromAmericannsul.eHin@mth eortugueseovern@Amadep0onappeȆȊBritish merchationattack>refusedtemenlPul@stroy@non-fi`shipng.gʏ` sX,courfutil"G!alPage 188irexctsoaft7hg*_[scutt򊈄bPoner =in4H`or8eq 񋸁vh3tifiPpreparYositure.Ή,oweÕpuimt@i0f7ucGepiv؇qFPnearhaeekwdelaAharbabu$Jdemakчirs.hKyach0NewrleanrmyhفJsecetʜxYl9!ChaltfXTCcpahlj0hcheavi(wa᢯sehrecicfacpy9'oeepewxxsbeqknowś w plepcnopossiblbigi(imzWhhsmagnifinumbض ͞dtotXyxs-#s0arA4violutitGrtϸɛ77ao`nثtooimcr`(hlias[jw0Y.si󽈾Rmohc8zavz!i)aȪh@Rrunkuoasas:Ԙublic̣2lH$'$,

ππIxiim3ectUtuWar1812,׾ԛ8qnyRom@akȞxosi@ڧtrsAxould2ۥymIvBfpundrrŽoaskZnnoye,+infBdaeނa8!ڴcoGonadv(ou8WЫ)alreadebxo4HflHrainasمm1suhcehiHicFe? no,s twy-OXvxtؿȲ9c duz'"˲ly-śjnnoadh1oub‹l__ɏqtt"appre8afe+ukepPؾia8:extengwillȦ@eaॢalm񜉰xms.="1em">
<0eight=v>Buthis the(ridXfstory:Ԁprim0urposvatewa oakeoneyortswners,cfficrandcrew. wholees(spirit]callingJmercenary.tnflictedamag@nzenemy,0only@cntHyaearndsparticipantsfovernm腈uisadpturtwy-fiveundBishesselthـ|ould0beenosxoߊe. Kr,eekygainri1oȎhmport,owIngerous P)190eǐҗLbgtexsibІinjurypHnnZwhSepra0tPaniSturٝ9spot蠡nou@xvolvɁervȣ"Alab,s;FloridΣ@S`oahţQ_\!٨hiexmȡb8uNEwϗconc؟Hopabel^@Jyqui 0gulahen-of-war.

//zreAic߰a1812hilsɥpo(oukmanysta e@sYmaiyroba9m؃a,iPmb=Oâ.oshipuckyI+⦩NavyeٰBa`Jreook:HzyX<3k⦈h@s8 g`remuat,appeaxfromeop()nhimuti0pa⪡yolhe(𮘺taken.Z du+tcargoǸXlodeedmRaAefultud<A,v itxphi!༸PnБoug symҾaum cikep *loo x???;1?9feф oRholi鲛ހtdoubsuchcouldkuxmphmo[harah8enemߎAgrobj$//xwreoH saiPngjHso 䥉ad)lockܸ$,*almplp t(ar`IcJ\ldyhoQGeorWaxngton'؉Mprdu Re؛oDW2HpbigPmpe,lfnw9ݙ(ec O¿ChesaPkeS0nonܰẨgedutrrewsdistpr9b(iQ4upPoБDz)ungoHMar,jfpfw ssachttSwQn8ٶwnɶ;ѧOPfifsٔq; AkeK-sixpԮgzfigCfxfaic( regupranc(MatK legal iy. 2:/p> π2div>
CHAPTERI.Page 193Ahapؔstors,hich,oughegun lundr8y go, xnott㈼thatcXearrativ&s_.tawcalma,qindomitable߀p0xnducmo`cruel-rheroinvYo2accept%da. Q;wibednHwhgoal)won.vpabserdPre0 wri|#leaguefKoprepjIfollowmi1,o3׌шHt`m;a(auprosecup?IprivfiPresid ππSotenthat]earlyayBm8tiourJarvoyaHstow*tropic|y d抄͑9aea lXleizzarroCezSaftermrdَbuccanePack ownbetrayeHmurdxrdesXpci1atioAi)0ttpeopl8Hr0y!.en (ld(ve guiltysme0I onggHimalsndowwithP 196Leְans,o(ojseun[Nሡ?'쯈˰Ie`rn<О:Hs@!ifB 0pohmbittaapa
P197 ππGeorge.elv0chief0e@UnitatNavdid@ab@serviJeanettxp 1879؛HP(wXrBpulse:___''__">I£Harchool:eroxendeavDzone?ɔsomes(d@ ih@narod.doˁdefiDenergjAlatwyj8誻Ȗousnes\youaddyxrdPmledЬэ0ld'eeth@]lifaIHsoul䭐up0(el bٜAj8y*grXeur acrif`Ql, pcam2wfxsilVssⴙmmun@@j9GoꨨurH8@thouqs(hsolitud),rrhaunen—BCРoooo77onThuXlTis8lookR2ic sexcsi8@4X@" pttypbи ;Pa198Page 199
톡 justify">TPfulltory—a(nceorrowmulatingDPArcticxploron,anotoldre.hwourequireolumes ȁ anglehap.vpartlayednymerissketchxl`ply.‘聨is8rth(membngtsystem0cttackour`trym`upofxresbegwi(unselfisi8uma`intivIn 1845irohnrank8alla0Ep0ailStwoships125 X,ekNwestassafdasaPfromim,Ptil,s errchy@yair`fnpaeso,׃9d(daaintlyritt؛h,hicp$deРtwy-prihxocis.enowwPI8ill-fhdedips.trugohwኣabone8exe9@;lsbbXawacruel. "Ldowdis#walked,k8Es(mauALieuMcCtock,BpYnavyaoudP⑈ p ???9200?igvfiAkelehssco sꌙ,yYfa؉qB 3la9inb*tK`}l̚zwilder`s!nloquapesdMcGaim1stgQop`mag q`pȮ)pictuthus:︷">;O(8/Lګȟcom)߬zerribXxl gazYrim)mو@<0 邍darkunrsyso{  `sQHllt.ȳPclo$İ̓!sleiaggbrlHiciclqetunookɯۖveetQhʋpS8adyyɢqqidQdefiap.Ơewin gla0eaȈH\durtPdraw`X.WWWWW">A U'afeXpRe궨oH{p!m hmultitud"77XȓlihopJcuim;,ZurposҨEܺ,voyh p`m8vec9Pomxcc8poH.mcatavemoa1P201Oxashies thenormousolumefiteraturenhich YArctictorysold,carcelyanailmpressedypertinacityithmen,fnx@iencolaregions,HngaandTyquestordven*)ho@sice-bouz.ԈHsubaln8zQditto-day,asoohi th1etstrganizingew8ˌmaycommer~oeчiPuntil, hapwhedAnot lea1a0scuXar(be9/0 lorɉ',Li!,sualقCo8+.

ππSoeiXDKaneiXsurgeˎFranklipTfoureala!brig "Adva`,svoyagthwarroughaf@'sHy.arrowlȒ蜀f*Șsx)8mhad phfir0.ȝship,X٘`@sor9wiremfix0Yimmovablxwo.eguerdledgeꊀneyReveHdireapurposebxcoy8t phHdemI9fuash@acrosruggfaxLfroz(Hospl4refug hophncipar2hrald 4ȣtSwș(Eexcepkhulج+serv`ib#fuel;ҋѐdiѩIЌick Pah202IWAcextraordh`RaWЮPage 203igloos,evourQblubberzuncookfish@atormstaplerticlesfiet,|garbfursnboavigatetreacherousayakossseadirectyelp,uarrel eamBogXeldic`suggqsedYfome pst saw,udygeographyXa8nownArc@egi8,erfXhimselllsyichancontesthsupremacyl!witae-.n 1870Ѐ(inmericHGThlocy,ȄinducUniIStsNJinmfitutxpeditseekNorPPole—Ifirstlopy pdefiAurpose0Y9"xs,s0(1yu CGenGreelPayswholunɗmservgive8im,ZantifItaf(uppliXȜ,though[ha:paiendeavlՙhȞ!onAnonjoy1cuca.eyipkeeLH,HrtrȔAocom d +.nthusiasmnatu ness
PQ204 ߂߂߂ڇ  jusy">x1dem-inuk+nexumtw) way3warfewiqbeyopoiqaf@ӾiH+apac„thsrib lphunrelsp.ϝi!impXoL2Ie 82asahȽ3a3pɾ[(9 epteod؋MʿPlmoincr(bl xOctob۳qli𶃘ed3@бil d8ipXHiealac(oss,o8searGges-ispbi0o8nllٶilef `unpoisst2wpara1itHruxvflo8`HjapmXY0Yhu,uА8(XdigqsرpXmțwHrusaiHcrɯ™?nkruickh@dp rgroxжYψY,Dis rmords—!ycou@pswVp-膑.ζte`7p'yy{l(eyi8a s>Pa205Page 206 E ify">W8sequelsee:yrrea)diserˍPolsIbawquA8ػ+wh@cluhq[build,A0chfolsp>aГwaHhw\Iphtɮfmercy]Xh9195ipmak11300pj ]:0temlauX{ӡ(r8bo`ޝ[pie6 ππTnextotab ArcticxpeditifromUnitedtatesitsingnouri nterprise.r.amGordHBen(t,wneNYorkerald,NalreadyanifesyhisЃPxgeographicPwIby dHenry.)nley!fipLivst8QhЎSDaCnfitYoHamacht "Pora,schbusserv,Page 208voy. ⍠}shipasad sJeare croڙђ"vlߒGovernthough's osityefrayallrgesۃsexnЖVnavy3EneMelvilldb(2gtg5ogeriwo |s @Í 4j ؅@niqu{merNࢩinf llow(ArohpBafBaySm9SoundesaSFranciscpushXZwarX}HXSea.nulH1879,e@pinchopysfh,8a3QڗmXrPvireHfהCحut—vSRodsWQr0kamopRerlyo8aRd-pack1eHrwhre0,crewidi0cultescap;h IIlencʠ(f8GGGGGB bdee0ariHcolstarvacdhwesٻ9besidereely lorrowful ory.@tutset ltuB茚'#.PB W@g`LɦAbXj̬rripaQؓnPbusroʉSQsh}bܱ$ctc.׆2槂se`rdHpvlhU8rtfluMocurrtP u0uHfЗimm@xf8Qcrhiso 𴰷pcri*exfyl9a".InowɧsysɿXcompar}itqrp+AumHshProa4rausomb,ir882 anoiȸtmo floHcbn .Apmؽf(ywy-fi0fep Xp-(slidJl(variXsele"jambeXpɿӿPmlar fdu(d&;brilikmarIyad(Occas8Xtopp9ocs@piehaga ؽ@ur A;,follow :Yr`, ndhumplacd؞@C!ԡispl09o9ü8KfsprPu zvgo(ʽҐg렰ڡ8etc.谁TspDVcXer؞ imgcx="00066"DELONG'SENRAGGINGHEIROATSVERCE"htl/>
ooookq1⋼n-Aex1ɭPiM\hplwAt0| a1cmworpJ uilp0bulwar hold;exercrtRsailor*keppat andenablentilune 11, 1880whenierce yxpectediprokeerairlynwo,bshepeedisunk.ԁXeollowweeksmonthsfcessantderatPtrugglingithledgboapgainstforpolaraturehabout 150ilfromHknowsNewiberiansls,Y8icheLonaidisoursi whAed,vp0zoft󃀋ymask0treacousitfallfullchasms,toeid.iv@pSthreqdraylmosuhum@exertionPsickeebXid돠worXImagipdisappointmentёleaderftЇ!1;ruelboiIprovis!劈row1moXscPybservaqؔ
Pa210NЛLndumu``atchd)Arcticpq#,ayInooper*ِnslyؙہumar on.19SdaiY1euphnamxBennett.urifeUasomecrosxǒǒǒ1ǓPthougBm҃seldHY0zi裈mpnit0h@uffse-burn.

ππAttookB3`pPy(@.=ImakyLXҧpr9\*ҧ3alttlebfpLp㬹o{tX*tstorm,R12XSepC/,se08On08dLieuACp̣lrhaHfouitnҹ9*seconZeorW.elvillwchiefnUnitXsavZ8m*yascenfmτ.Ȳ0ould1bed#輘}QthsafeInliku@Missppi baodelta{ltipliciHyṸaJankڥuntr8pÿKitpQoh8JavigCany8tan)reefx.orcio axsPsS,:an1nyY[)noDbjԷ—RnHhرpp`yࡂhuh):Hg`m8hu Duliva’sYts|foo(eȽbexha1ĭYw؏Qeakڽrl,chzwo͒xrdi,iȼNo symxХ;Smf(resuccor.Ԏpmȼxweaiyadvmsailyg)@nprXRela`deXmD-'sn%0ekqlifspexphpiul:///+2/ZϹϹϺϹ>"SPa@Octo` 23133ay:Ź bod(2ak.lx ɵ1Z$nq0BgetenougȕparhRA!BṹrvicpSuff8n:feeNot-g`.M44`A` n wwTues55????>WednS6V60/ߓߔdiv>"Thursday,ctober 27—137thay:versonrokenown.

ππɄGGBFri7186873dieduringarlyornpooSatur9th`Dressi؄gheɉOOOOunx30}40}Boydndortzr.llinsyώώϏϓ">This Qlastntry.Ԉhthatennxit,cmanuscripthows,Ѐfirmsteadyoughjwritwereittin )librartome.ordQpellxoutqfull,unctuatic0ybserved.owoafXset"eL9too,on y嚐now;whMelvip8indehnZNorosdosopprivjXreachspotfZdeahcamp,Iepa!rowcenI/jbosre8Hpartb`!Ks,YŽ(JЏiXJeftmŐh_waboveurfaceԓɊl.mmediaterecognizSsapta,.mblerК`Aham,cook.sqjournalh+ory(erlbi`itث0delQҗ*њossbH rBxuldoV,!e0warpfmOOO[few|bfȇ`f
Page 213P 214 ππG0lhhaieu ArmyhiPxpedi`underBimmȋ0xreSecretaryWar—!aRobertincol`swarresident.ӊ crPcism+xps`̊*,pdtilingers}booksywxsubjH,yrnfitn@ `a`fiه1bu@u:0e tmzT0RwHLockwoo0Ks@ttwHy romjrankfKcorp0"sҤfor3y.xstron`rn袵Eddsraelougradu1v`iPMigavolu@d.eo.ҍXshotop`8oen魼FgSHxgeߦߦIhsoubtfulYyoeoP( 215c0tkphܧ)r!iB@offȿdoؗEtɽ1[ofHr)hpɵˀkPooug;W`taordVsaBac`drbeaQp򛊱0Ccompl 0firpئindH,b`st񵵸issuXhow陳]by$b8¤;W,ow"hteusk"Yc,剸@isqno ng €Ƞ,ainWǿǿǿ6ǿYz ip!:H*unkrem*l in#pزbure.ɠZis"xacqumm` ghj`,'ackfetermination,aucityfourage,HmplHnYnce.heyiyeftree`toisawhileimetillemainedor:rescu(xat@astthenvenientHpositv9storeQprovissyroughtomvingabandoexplroarve.

ππЈJY䃰edii Htschievem0saye@bketchXhily,x؂AatropchverwhelmPxtold.sywaJoht(icsavnSirohnranklin's,o,@(wsfruitful`ultphanymerican7niQwrZHbook.roceHb Raler "teuskAugx, 1881a۔,Arctz:redeithuittbl9builtHmodiou0ta@h؄JDiscqyall8FongPafh UnitS Sehfrom͏iganPnn)oulde0lab0ዲh؀iEٞaB3wedeferrunfollowsum.ifۉ]1noisag؊A;(tout؍odb@cW𔈢3gameythʈ nKofficbeg@lectuў`.usrn si`quat0if`y. AresfifxyardmY,Pp 217 ππWcgȬd(deKcircumfirreliefiph@ad*arr0d׭p eperes1l8nqlsPp!fam.ٵxyǁӭկg8shakmxt)ѴPpY'sa0publis0+seitabijpIxmb vyaccomp@ntұisonؑ)xamxiءa cPbadvs\GAcIxsН.f;Cjfelt Hip@f 㦅WarăKJhimYum,whanUHQeydoubAysafepbepC-s"ovi0eH .½0itipftߪm輁kupanwhiЯjciAfY,,e:eoi8cpps%YJ.ug0 9, 1883k84Qwo@RQPerX٭<8 Caeӥwpo۲.Ȥ٥know`ekaxbe`ni `-packunTs"Yic,kg8ot"mdyav1fIqrbXhذ0O$-fieldHcroshcturbulawa heartyadetsayoriveundrediles—fourπfoatingndn׀sledgifty-!dayheroicxertionhatghtellakeeageutsthest(@.ӃlAerctover "hummockkcs,erhapHAmowhmroilnowon,jwithuchvyoadssreelyarried,@Pad!beatwXsometimth( bpenouldcompli8higackftiYetڐ3wcheerful,󎈎jokrirrk dergean(records.inal0ya؎XviciniȑCapeabin goodlth,#instru(1$󇨊farm ammuenoughprocurepHf1Pabqckgame.“didoor`abq c:supp(b1irowylow.בpG{spXXwhi reliefPpedҝepc)`it1possibȚҚQg`tՌStaǙ)n fa‰"9priseanyank(whal gladantracHo fill?JlooupildpesɢԗI@nagaМ,f4sappointY.̃nH'premed.ŤmXhsele0xX4ʙcСfary\wqeo1cryئh(ignJaurbas99idevʢAanf.
Pi219 ππ$requeHd,cgls vҡG5ieutenx̲w+iary:ooo77oo">"WAt*9cA 1s:rst,!Amc3suffQHIsab0a;pf rai hs4g;2shootyϘalruX! Hladu*C">HdelusQfwPl@X imp lcurricarriaȖRoIf;t,j+sXoI'w(PXBa0n'sH3*pbatwm!isidapefrom0ttleȬ@MhhaȨXs0rab3`s@Aeʊa slZdiK Გux2XcuAfea"d#took"8g$+ inۘ/hotDtwoai`ppd) DIsunkIalmoyȴIs 9.QcafulYdi2G`Thhpʘ,Ҟ8ographaiviliaL蹈ഞademe޵r,peadt rwiJensEsquimau.ctober 9heyeturned,ringcordfrsinkр|"Proteus,sndintelligenceatAre)about 1300ationst,rearapeabine.Ԅ?leftHneyarlton,comm8OODexpedi,whichipbroughtackoamp,0adart:Depot색d ... 5beaKa쁀canoods.cH25YEnglishn1882isit`mfou@Pn[>nittles.o(@Isaba..S 'Yantic'wapoithsercc@I lldeavPȍIunicat XseesselH؊EverythpoXя`beorescue (Greely's)aven.

ππThisisco1hanghgaiIt(sopelH attemptauItewelthouspɒmrialievX Ewrnowmost,oem0dr9`strmakeaZhimlroy4uldragpewayhyڊJ!maracroafrozsea.ϏϏ">HinscrutablimpeᒈaYXf!ooj1wa(Ipful8o􋬇B,@׆1@hfQXsuc+7g@@faccauȯ;ipwhelgasX— 9wholHbeerro !xit`{igjpy.hab@`cu
Page 221lqrap@d!whisa'sģ(cirety0ɶBʕXט,dIT3A00Py[vodhּplousoyalȃѷ!.+77777">ɕmɾmbuiaure0rj.t ᯨhxvide)Ar`c(rdppi@شIahm`I 7)unbhaH%timtwo6regAerpetual (`wy-fiXyjwellSeqful.ezI!cami0.">TXPpI!pambfixazmilf'pP222 ππTproblem9IgrimxrtaiPstarvatiJ(@+*veryirsaaminc؍#Garltqad:enragqrepPs.tapesabella(ly 144 mehw0f,/'s00sd50 mised.͚yr9doHiscuitpP`gre:m1oughndemn8byǁ(ly8seizfsqВ3devHravenousmapunwHesoesWqNmb1medai ¢ixьxix c,rϢRve`a(s—abquarqbodePPenaȜalthy.ylgissutdowب@piumXtxlculp((Khh @a`ifetils:MarchЋys'0u FremةP,mak0ftcrosstraiLittleIslcLtԇ LieuawampreOfrs(gqshodHzڱ:;Page 223bxkfaaAnea-soup|slub؞usm9qu(xerv0pooLca(Hudri[` P-p2'8LoF`@(comhcc8nywhiidHw:yGA,lavȕɽXphln;an a @HudɫDraisiXdensmilkfBwahoco`olldЋypund*P224
z

Buthatomparativelentyndoodheeridotas(ong.neweeksHenhappyen,ruchs lllungoife,reXvioeshrimps,iecesfealskinootlinevenoPofff.Ԅshortenf)oesulther,rokeownal nsom؈byHevicro oh.nlywothreeguilPise—anxecrablЃ8kmergencyfdRsPrivateenryHh腙rdpLieuantDŽ owarewinter.ŋIbefYC(stma8casuaXwhouldaPbeavoided,Hwell-nouphedstr0egaEllisma(ggallQheHH `Isabaoverhy0ЖfPguDfroz` 1hs3eett1yroppHcajreXickPhowi*m
Page 225 ππX0f,fastXda*iaJ,yRJhhz ߎٺ pc㐒nIvelo2X[nexQy8ledgri`f:ngPhs @liBerrQQooۤxßJɵrmhCan/*Ȯ[cglh iXIysirt@ic`۱w82dyYr襢n_1ėKroFheN@h;neI.@ tiinwn꼀kayak茄p baiec(.c,׾l1Israelەrm9D8Pav*urge!X,sawayooQwhy`pn(pfulhnicle?ԺHPa`226 ππMenEnglishineag8fotelgjstoryXmeetɅStanleyRDr.ivpn;depthsAfric`jue.orearsndisappedromclizworld.verywheprehensiwaseltestXfallaictioBferocitsavPs, ؁p0itiallimatTBpithpeculat(soncern!hi,mmisy`solv yst,ymmeournpwheLoHinArc,JcupaugAF*,8l Ѝoa@aiwwhitؕ coubebmim t,0rlltarkgloomyProskinJnPo-Saxؕplidassert itself. LnacyharushaAeach{s'ms louejoicI.ot؞swaP9227"WQ,Ɍplieve, inew@er,aigr4acquȟ`Fif`Avenu Im͠.[OO̓*gleeoupPitI takpljdraw -remo)Heؗ('''gcer|imgБdex="00068" ANSQUIMAU"itl`U"/>
?U9GyTic>LtroplۯwiHn`gi0sedLDenȇ=advguaGlyfxpe@mзYTC(иYFditnessCP0(nowdmiral)chH'sook,RescufϻOOOOhalf-pa%б29(d#PkyluffCapeabsmad`waطcou(ur3ЭЧ8Colwhmembpd.)ybeXragonsxvals8)bey,Ȕ9keptp drIbi*gРopkridfollowq9wXw0.lthhًrcpYbroЇ`z—duafnoonAtbo`arАasS.߾ϾϿwwwru@$jumfexh.Ȟ3ahy`eks@ѥ,Zey0hэxb@doQj8YarmPrڴȹ` shirja(tssxghtI.X0mocinunHlep tiQlepspokhعzaI!jsumb`Ata0sjaworQonvulsXswoeluddhimpؼHkglsndhookolwell's耨.

ππ"'Where they?'sked,rieflyInent,'aidman,ointingverisIulder, 'hill—Udown.''''''osr.reelyIve?'GGGGGYes,P"@aȀ span>Page 229Pa230 ππ"'Whoreou?'skColwell___''__^Thean deoeply,taringtiacantlyGGGGGGGBgain___''__^Oneat9enpokep. 'That'sMajor—breex{Drawlhitookbbyrh@ay8: ',酑(ғYes,'id挰toice,sitat☨shufflQwithsords, 'yessevؙuseftThewrediDliH.ĄwhamePotbebestc.ǜww??wwhș8fbackxhaedSlowqcautious(wnur:Hlifhealth$asaveo`Ellison,(osenfeebcontInhuldtᔁshopnecessarm` p8qmhlambs. nibodies Page 231Page 232Page 233 π2
CHAPTERII.2'WeHXǻǻAcِ"twurago(bIroquoIndia`wXb`)`mxOntxopEMDetroRipcrhyClaiHuPoiȅ*y؆irnavigaGb!npe-lov boatcert BxPmpmev8Sxqsur b(lpHicoɅohad`i ultca@IYibHdispXlirËntroquois,henvadersereestroyedfterix-days'attle.

ππIts hll8m胀ofHemonghiloso8calistorianwherarHr ,rissionaryffortasonermo(todpeni 1angwildlacesiworld.ach,Pub0sitsart,ut@hafindoGreatake"`:aranosavag@followbyJesuitiiasurnuauxvoyuemplHudsonayompany.
P 235A*9xdearn yip/dowl:annuoccurrenhhfa8walmosterpetp.n 1680*700p,ldllinkp120hbrxablisheddrov[rXeyo͖іppi.ƗXy08natRul }r-ftweenbŒ rHu.לٝXÈٖundisputPposs,ommerce;ixthnavig.ԏi(`G\h nhunt2Pprincipbusinʙ1everequЧfr(im\oXa砊ȅ929fou0y.,l@wo u`;firspd+aaH ҧYiɯp.y osoa0g,elIa8auulsSenecaHohriJchief)ѝɖ[Prifa@h{duskygoAes, 跘3;sx(ncѸofladyحix`tep]rosec*CcrueltslaPÖthinϐy8icÍԾL8 8cfleړtHfugitivn؅3i`(Deit)ҁ hrok$floxj`RinHal襹ѓrowmselɕ@ehpom0;yQuspescapCanaQjo0ۭJvPotta蕰OrCh鱰pՌœ%bXbirÛpePZf'succee)induc@Ig(ܪ5(a (tKm؄ mehٞm2clumsily-conuc!Page 236疯CommerciȔ,uus0en*assum9maan#@iteuds`B (ylwaysxtendingtserritoryowardheorthwest,entJbateauxndanoesntoakeuperiorarlyȂ:seveh@ury.occommodxi(rafficpanyugQalroufallsfBSt.arieiver,tpoIwhll "oo.sɅ8im$pigmyrogen%busiPTworld,ecafilledi@débrisp9yxistenc0orgot`;to0ysgtudʊKthriv nSaulte,ro8{oldooknHudsonayË#,Htic؍QrHreferony's[.h(cou(it@?Ȏ@cu(sityaXse8aidUHStsnginee charg(Cnewmvemeganpainstaknvigation.lňditchBdisc\,dePa237 ππWa pib0mo8che`)clizeJAoѷJadvIkirhpeople@droPFp1812[A`ieBountr 9٭ٶb(lpfu!0i(ii dnsP"yXupѫ8B@kai Acdlx9:ڈo 9Hh(tffec@˅flYnaXmu$ mloPhV۞-Dg\onќЕwa:dhabeyusggSo@sy鴸irsavp`׿׿׿8׿sp{w莺!GɔqyoNiagaraƵxq"Griffin,sQ0ChevHdaӷ1 1679, oHaBuffxxws.8hbrړbFr-!`9g{Š9navimn"leu0Ѥ(HhAnϋ/a@ablIѵltsSnaFr.ȖImnc(a"ik;mje0usamyA1X,savantagonism(áItescapurصHxnugH{howesued8ntsixtXpadePmism1`n"hre@rquebu芡dAaiyunAcMHvelhnColumЙ0f+copɼ{wYexhibi `ZExi!.½P؃)hZal2kXYepcsyd˶PlenghEripaЉaDeRASt.lak;n0h toackinaw,ndhenceouthnakeichiganinGreenay.tasirstime`yesselnderailadntereQose؀ps.0ps chartzr)none.ԃswiftushingfDetroitivpflow smoothlylstp fs,hȅsteamuo-dayassautiously,espiteRGnm`nnelxcut(epJplainlighted flatthatroqxpan@0marshermedyဨzfalpeb,ŽXbreadwinoruid@Ye`"Griffinkdetgna0twy sromvs8pcorritnotqual[lumb9chopres9.ƃ,all" b#a Page 239 ππ<`n="justify">xdculpPrmiJw8ICex >,acert)n@8sؠx-f(c.apionanr porAah攙Supix176631772lexHy(ia8`oop-s(,ou(KamȒH(r $lobeeojQyinfrhghVErimXvs@ccommon.Ŋ820߷yd(CPabauxWWTwoԒAEBer<ladwin,$prdh90besieggarrisp63 _[ߖټ@upٹbJbIpEngli8)iviHҷ`* fusalL蘫b(asbox׈aploshidredt;RoyC@teBpoƍVichy0lwqinXissiBtwFk(Buffalo),Tir:1,4649xi~practHest8XIercinavigat.Pa240Pa241 <8lign="cerȉimgixx="00071"`"THEEDENETPON MNDLEWtLL"tlX/>
9 GGA?justify">A[cljth yur3-lorhardup(e2ؠhao)lomo(pl!ful+air wapsedHHۓ9,ؕHr񮨧rs ows:«_Nancy,SwanqMegel;T*looaginaO @BeaЃ(8rGCpЙlomArabaska.T,*lete,s,bMich`nww770-ksQ@ises(bbȩeSMeiaHalfHCwdꥡo@ncdaqi)ГYpydescribrangpod c.icesqu8tooBy۰flaHl p!rt{aػ`co,n#aoi(XgHXrsaPpt el)`aenuilyaoccupaѺ+musclȿneQseemipaddlpoarZȠAwho@dteamboafaY=realpoeؿdaw)naonaor8val+asid0sKRpкPcausq0`ɣQroughaipaPlifbutc؍|agatwqlitrogмJhay'oxgGGGGGGG@2DONEFIRSTAKEAILORSv777__^׷׷׷׷Oȷarli11igдԍhuUnacyJohnsClP1PfiftyHbeaboH1850.WhI@kPon Captk]span>PaH243
ljljjify">O藈gun`qu\hwa{xrapid[YiveHҔailr:can dapp99howdoimpetpgpupbuildbregf pohd acticabpwXrTtory5set)MiddXWi@Aāihrr)txmmigИvoi҈ensshauydiaruggmoaiɢ⩸bAisowheeavy-lxngpcuXeep, ȏurPotomacOhioHud,ohawkGr̭Samhasicea9bounavay'o<(؍rs'0wHused`oȢٴlat+ffamil goza0demsooptӲEbL\nearxliYn@wou藂phfulpq0iXBiQocspjJfancqړa,]span>P 245!stؿnsmakAѨHP'In 1818,iȺ)ll8x8icear(̢craft<;š[KWalk-in--Wa҉Xme,Qx+cuЅxal,(cee9d ripᠸ C9romuffal oetroit,—8rent!thirte Iaerxd0PPrΧr;YuaabО؞FoآxSuor.nilt`s=PJservew[ioailot-ea8y𞁓rrHmotackixengthvepiphuunbox؍Csai: brofit↜oftѾ ft(angI|voyHachar.ưf)no(^buespProbxSef`FultLiv tecƺhp깋mStN0YorfatiȼJxsoosevelqaHlalȺ0`4pticaddl,layexsʻLsidgrrA07aho apii[6777 wreckH(Octob0rm.ñ0AJOh hvyaz88a辨naybxsXhh@waJno8vQQlosXHos$od irrealami˜(wq.Taccnt,: citک֮t;may
Page 247 ππItscarcexnecarynote(wPatzapprehePp%8thxPz0ЋMnfounded.te`n0gَ8laknook(XbHoÉBecraf9XtransanticOe }disQojdictsci0ists.owhPLl``su0aqctaclmarmPct@ty, aAtinuo؏qBfusargo-ships DetroRȔ!througoal8ckCSoonalIn 1827firjbo peault.͆e,Hamo(assengersener Winfie@Scott,aisȖnzmhtpo8҃Puadf1ޑ.bofHs8,'tsmoke Y,Ѣ@IndiJa,CagopigmyIerunؤfleejhuPlevia!(Y2umngadayPblackPT'kyiorr(jskeephurrytsum op@drawridg-elyҫsHwoodcoursjyZۘYHhituͭyJLwthFsoPru0d]Wkept̢uperitAhoNjѓa21840C0xFcopXP!borhiup*dpɲatcaplobecȎL45 хp0ʢrdwouX@ɨIVhm2wiضailpulicclJloop4Oce tPfiftet 0fPPa248 ~q ywjustify">AspڈИɹhtherojectfanaloonntAtlanticndacif`oceansCentrAmeri(sthmusa lmostassedubspherediscussion*inth脱ct,Yhisuggestiveness Page 249 ππAheа׎ᝑkpimitabbedrobksih(d httIcup⋀"rlowith shlQeҘemplog A0)s8›nɮR&md8;DuluWɈ&beۮr9ippq3.Ҕxr0 uilequ0fȷpur"ry텺cdሉrumbl8aynStwharrmnim(hlnavigؼ8ٜeTepᢁefalona`paciP:six~a:oۑ.erha(no☘ȏYaptectuHQtypfitoixific8yȥmx* n򌙼Ioa(`yoRiion%c0id Xcaaux rde n@Airpsw8 mQp8EvyathhuXut Lstormy lPy@Zliw .Ɔwardu@!bulPzqw20 en ecaJY///+1/)crewxX)ackګ(isack-,)tai=xX'oomQpʽhfbridȹ`elreGBfua؄Tno pbntwexte9Rf,okHc hfew8axdowPl߉Aoor.ĢsummextohworksyۙhaojB+topspXӿHshdul@m9 o8eau0essal.ӯžssufѢ`ѴaJa8"s0pHsimetimeman(s9XZokXtCZpÖݱmchHsbY械* 0(omcnA!Crŧ؟ten- :,(ti؇n'ҽ)mxȃ̾Jxr#XlpͿ(-,z׸Hsel' cep;m@*.oXr-tBcommx0ulkXdiv1ocea踫M8niPc@{er< simpaHk-boxro,stPoXsi8how9Эc thousandsfonBironourednromXasighbovehelooriro0Haree-storyuilding.ithesselsucHse,jcostIcarryre胨been xucbelowlevelfrethargesanyarIworld.

ππYehomfopehaxbyoeaaverked.ԉhquerkofficm superitooserovidhmc0in,:vastlet8@thbffe"tramps.͉ىshipapcialuest-casiPdp XirwrivalgかduxeWQgreyhoup.
Page 252AШImql𷀟 Q! 3moh8whaleback,䴠moncدosailpigncigar-sټ*deck2zridfʾI#-بlickړ㿩i*afe8ab8aɬs˩hgIah󤀬؅Džąp{p1duc`g}ac@cGwep(bofir֨oaQ<101e s@lX!ɻgtZжyrnWil,elle{uIun({+ reasHȭE0yCHor!77733711fiPwrH{0hбfich.I%Columbianxiٿpanger-F7;Chrixpus׍Է0plɶ@LMԭI!ibhpr vantpde:fDgo?bٻ9buhclaimpinvor,lexXXMcD諘ssuikabil,Xgener*adop+QŝwzPMשhry:irȣjfbp#б*.ӣiffeholmodؿ(trazmHS`'Isecher@aref="$00076imgci0x="7"THEWHALEBACKs"8tl/br/>??ϻϺϺɩir)ٺ[hgrowzsiЧ9qp`{ڱ"(oqlzhipyeXI18569ьmOnagon|ytwo`nty-six o`o-daone???<4?iKnHs"zmakewentyripseason.r.aldonawcett,hoasublishednhe "CHuryagazinecarefultudyfisdustry,stimatesjtotalregoforyea8tbout 20,00"ns.Ԅ@sh) efleetillangromreeundr andif!oHvflengthithdraft9Seighteenz—8whichguPithopntilHrborchanneldeepenediroȆavera($35򇫉5worupwardI$1#B uallڌspati!bso ucPth؏xsomxnstanc p riA{milonHeamen,oXquarterdeckKcastleybcompariȌ#salt-wrre YplitixmanhooInd,loۑailRakPna`qends픉ydevelopH:ib@n҃Vjack,ښx d`monМ,Xrˁ,;nrdIf ing pdr(a2ign ,1u[sgha,hᎀ.șHpltɛntmselfBshѕ@kؗysiroa𢉎Cdur2rJabssefay ytn1.(rora-unap,HsXgupBregulRcondئemployyeshow,feHjceh1ȀQll-paixn&9(cpg8re-asЖ!Ppro쀐6ӒAcorxsser"$11,250؅}sxl unusQQmpZsum8inc$45HhaownqtHqscostepruHb:8ve@(P255 ππ)can0xSaul0tM ʳ!cauHdigiousRixIruc*{mha@huryВَr@XgP7ᓠpublic`fromUnit`S@Gon2̀ʼMigan,ɭ,𚩽3+aiv1ny|bui0ɻi:Q Yunssfactorywi˅okhrolhiwasᢨP(ʣ zoncxxp`ab$8upenl8imvt ScQQ(oe鿺b!a﵁w"(Xwouldl1butEB1881t綩apacitиHfourH 0ihcfhepthlockI`r8lengthv"`ivЃОm`(aluAlvoBqd(twLSuperiHu.y6konqrougs#eaxyБcee9͸֞firx);>XBpmʼqJmhs,volh|SuezBpڗT*eb`ishireȦ1fiAmunBbe Aoc.#sSmUexidopt畠aXnatuiobclHt8$paد诈x}ernxrxfi ou@calt-wiPcH9w@tl"P257
ππ

Thoughheldaltayneertfreshwatsailorhocarcely Xdnow tooxcompass,m:artfavigationsnmaLsimpleractisftingpPpo8XBguidbyeadlands ( `htq(seld(lo(ou2sy,nevfa IaiyeKplslakeHreuitsealAthowhich0nn[oceanPamanzkilcouragecessaryyithst`mgthis.ԉ'estfeguardBimtempXnty*earoomI-mȈha`F@hi(alwaydHle`hoonPaewilh.ncHҍyttOHcxouharbor+bmodifficuac.ׅr_fi|bay,ihaps|ext@, huy`crooffarefu@orm`xru`nqnarrmHhiȃpr J0gonmpXkhiddenØctwavavae@iHel! .Øago,lMi0ukee—RЖpn0suHscexbhipwk:dhYdoorT;so$xtellXtsonerbe(caupb0evthkiasarkthnditIrroak𘭏2Rci؏`wr`s3sewpȦnbCiwyasi o,lq) PA259

ππFyyitpxiba hl0"TU©%m ne. nt@aewaofbdopUndtqI, "ki`.(digiQoursym`SkepQ"Á͖c zHۻy>:y(@ cunchigg)B\jpٿyXeliӡ2qPwȫrao0bؽHhlimaxo eached8ʢBdGrnꃺhm0rarrihNiagaraOOOK60OICnlIYremXunbrokeE཰MohawkYout8HEanal, 0䳙)SLawrencp2aepenٺwidkDpXqCdian#$󃲃+zWSLyChamPaw [)vPPpco`worl.rderingnheakes.ԀXcheapesthips worldazreuilt.lready:GovernmentaspQitsensndcoresfillioprovidwaterwaysromextremeorthweHtosouasnTitythis{ym, isnbelievablea1alloaviolhlytoppe.ewevic`foriggyals;uch thosmploylChicagor(agannelnpneumaticck,BpowIcapac\wheeopracȆxyXlied,vehdecsoҌqmultippdmazvalueYartifici؎ȑjadKygtnesealthYorkt`epӅdiEri,`#ror9populousz–phPg0penXcHwhensailor_-Be٘givaex<=ocean.PI261 π2
CHAPTERIIIP263 ππ<(lign="justify">Nohysicharach XUnit@StatPhas(n oۖoZn@zC ππOncecrossLvidÍeaimmigraAosyowOhioiMi9sippi.h`meoutpos0Frenpower,ʐburstpthat焠tQallowing9ir Page 265AtlacaСb(hoff!allRurrexpPؓJmpe@wifur"sback$LKX0gAlleghan9mock9¯aro(buildHhifழFةIf׳!GNat鱑cxdesp⛐let.sam(Madiswrote: "i m ry8YHud(Dela@beotomac{g0coaoZ袄#ټѫ:6בȾX1786hr`wi徊dowthus 葋qSiserxory,#eкm8x!YctakhimtIL0lo,nnil`ooЂopQl)ohom!ellYQhaQ;nRTPAmi82sabeckn"le@xHs=hmaty(doubQ|¾tro_i.ȡ\nsenPjoreruJXJ*&tigsths /mrurnnyox`quedefeny 0(Ȼagain9Ekyqwhi Gen.lWilk(Q8i8s 8s襩seȨartirx"׶higic@Xtxougx:dooؾտ:Wcءaref="$00078im`ecXex="9"8FLATBOATSANNEDITHIFLEMEN"H؁???8/[br/> j ify">/ iҷɧs"A(relemB8kitoesotpproachnorldHteresthetoryfj8ievementsNewnglandarinernll oceanvglobe.ittleangerromempwasncou2d`.ԄXnaturalerilsovigatixwungnobunanticind—hifting-bartreerousnag.et, earlyys,heflatboaLiltincinirЇsburgithigharapelogravyimbabohirideknn!on؈ɎHkweepsRhoeoar,jriflقlerfyecufim,"atfAlurivagcbank8HэUvoyathHmXt ffecvp,hardy݊1BedpdINucket.Ƌy`ysWU our ry's
P267 ππFirثcraf@o8llowGnnbateauxU|monpdowgtvZatame12geful Pselyeዂwhi peop౜Unit0Stwhapmoثxl(i4dcҳyd݅鬺Hoewe"Olympia,sSchBrooklyn.Ayp`l寿صKfy-febyxnxI[Aaeinam2cdrre$xer.`idЯID,deck-pؕabihJ)HRehpn`8wo[@d*p9?a:@pul,1RXw{urPpjep)ix`З;fancyQNrmhor ،ӎ2 sxpplis.urettHdfill jgoodfarmickcommhhim`#Pittsburg  hfamilcH@Zackl)Plidy(h0 pKlogΖDXdtagain`arbuwȃskin8>sQ ȱ*¦ark.rغs`iZľP 268suzpoffikiffo@Hunknqaski theewsrom qeast,ndharenirevels.loatingopse(establishedhio:itsributaries—flatbHs,ithreatabinhittPʂlvestockclothPmmunition,oolagriculturalmplemenQ"ver-preshisky8hichorm(arincipf8adeloriHApproachaumpyhousЈbankamphibi"keeperouldlowustilypha@rrellzinhtafl(owo֌ orga(bgoodhatcmeopuPHc s14x1܀gam82;add civilizidvag0o胹bosoTwas am؉P,currencyzseldsee99outlyBett.k 70ducPP 269 ππTTniempoP؞ȜasH stF҅urJl-J `d,hulab{amQsch(requi(wy-fA alaopsh@cnTeth90xsqoyedYe "@),䬈ottom[〳at҈wal4bৠ0eHo;w-xec@cordqfiny.Bdra8bylo@`ranc;lb|bwhh.xbecam{i@egPedzJ()notXok((\eHvoyirirewkʑCt0vyerrsºxlxlbul1cسd oo enraprou`scЍfiddȍȖᡢ,ou'war-w`p(mionsoyhP񃌡"iOntȵiaboyiuh̨s1Ohirndiana`muؠa(mbibߋseaҪ̈́ Engl.ɘmeшʳA ham̔olaSlowt maM϶Birsawlav%2v`ٵ`vi lif{8ɾ70s`-PHo8ڦ3@xperv!tangtoXidryes`;aع dH.igflou,apدټ؃ p`hoxskymartic1lt "w@&bigarhmo؜fopstacarribzgriculal 򵐸gȭaTsaa'Ptey p0dዸvog@nrӴbܾAЋUne0 Ofi0dZK #䏚yor٢Kac ;ew(`ruharmԷ tunRtoonȴcupHr8fielirxcalspugnaࢢe˵ܯX3vЗ|pHstoeThalfrsȀbѶĉdr)frpߞpaknifȽistol`@κth;gzntagon'sypeedihHmercy.I'mSR1r!bawɝzHigniarist. "Ianutrun,Ajump,hrowowdragndickHy큹nHeiver!oveimme`qI'mhofullfight!nyrewZbest9wasntitledoearearJbadge˄wordhadoeferencemoralth,Pmlyxpresshisemonstrat8abilityzhipAsm(s.hey8irongsoo,sual sщtalsBqroughpnrthatyXwiQiweep rpushpolSome(Hbe ervin1tory:

align="cer"tabler="0"ellpaddingspacsummary="It'`h!2r>D4sHwalk,OneYnpJulyЀPage 271JH`lim`hQWabaspCOhi%QShawneetZXcarkQlihisibetЂvMissppiȰoodKpaXngerdebKfIlXoi𖤱ȅR ppbeginjreturrip.ecaus@lq0pofSlaacquirputat9aعYPӤر#neradSuezannholdpIlQh0ri(꿪"''''''''''$rup???OpSwd7WW5All*wan?wsPuHa0,]OOO">Yaavorchorus߿ߞNatchez,enne$likensymQR*֛bgrtcRexcgproductsMottoyam,sugarlɤSI?o?77770 fXelqvoyagt-relimostlyԡiflespwifi RmhrouYupWdepth&`bstmoultmuy(usecuкsetby , noAfrequpl@ft.i@geeboccaalshнeckؠPeurs'un"Aalѡrtainbrrewardihapw9k(deer.fosizh-1">P 273 ππBuatyXavXhad䍡roeetrobbevadr)outwit.t،imurkndian anks+ dep-0lyarrowbu@t+soickipulovslauer.Ǝa+itavoriruPPehAsecqwhQcaptP,1:`(onOr'sdg8undaorЂhpleȉPhetch(hszaidrafywomarin4m@ppX3backuntunathihn+us,aymrhavag!dzppIcaha erd@cyD`icX@decoypfstflA`s rity.Ԋ˔plaw`gtoo;air(sϖФmur9ppz8J㠃panish P 274+NoЬAre&enem (ywhllchmprogain0riflrmus llLconveniyhofig.a$asixHc ybЃlsoxnum8 zampQup"Kamm ,IhmanRchoi8"mpюknowlA.#/////">9E9پжmminousara8hy8hptecregh !pimagihsqiN@oh dtOhioonwwww?wwMlo0aMi0Hppiҿٺm,ujday&cxurH"muHs)aputMȃ_CceȰ.Anticr𴺽8haun`abuccaɏord@freebooi,heq;ffa lug,hapLwouldySVvessel˻(0tpaK)g̿b0grpudac𽁫ɟramifiHssociډs0sl `b`luial暀gn'ji̓ y`ҺP ؞uiUSЏitಱ.JroYsafitg@criЂIBta,џDpuresqueAmeri Ȃ.ϏigroupK1smX8rowl-oak"ȴ palmBк!ػloȱY8hwCHÐw8{se2ayou, inԊtilz%de8kPa275P 276 ππIn 1809`9YorkٵyHN8s.opvelx 1Pspgqa8atbohzyp9oz؋`.ȼrrinoYgogoods*saYndinv١ePdr`yjoPon@PimpX -f2on0 uckless(㶟hPXלڨ, iwpg1hмIau-ectihod S>j*HFulthLivȾڨheam Zprisihi)uȖ3q8addle-8elEmorehanalf8centuryaseavoriteeansftilizingteamowerorpropulsionaboats.efirmnbelieftBgreatestu"9niver1iedogeKrapidlyowicommonwealthBmiddl,nd undertookisoyagpurposeIstudyAAc0nel*urrXMc,ithviewttaasP#m.i@messimP278Pa2804CÆtna.mdash;volic@P#uP8{expeQooQy(ly ₴*nex*֭@hx8bee# makӒdägRvillAn?,;E)priH|carr(0oP,wdٯ@ZNGeHPժ8اXrvi@ s8nQretu*7ayThixachi`臘Qheop`T5wcertaɢ`ɨ4iȃJnes9P ճȳB,banketw}Deإ_7|O@zapkPRQ.QetHXBboroughXhjJinXȏ{bfar89 xHthre,varykn(,iEpl$wȹFoub9?8eȥRhil8lphia,YorkP0ncf Ohios;`siHrrطm٣̻{offl,`|mpul ritor arTt8lugus8iiUPik7< *asc)bbXd(,dӓʕoiceIsxtesctih;hppecrؽbab(ppI iolȻisp`s lmoPJrgwicabsitud Py281Snowadm0QInh90 11,000!Hsgr1ըPըsyQ :ria!ccordSnshh,15>ɿfreRannua,icoal,, pbropa0el#itb̑a ⃅ѻy2urbiot;ug1 nmegree,akehelacefrainndroductsс9furnHs mills.

ππButtaongimeeforeteamavigatiopachedhythilissHigures,Rindeed,Pearsass؂latboatbargaw iroomdis@ed.n 1821`enafterirstrrivtewrlean0(pllecord`annal6townalfourundty-on߈|OdevenXs. ytwo y-hlsopXup蒊lيKQetdaysғs1.inexntyp:vewerviMissppitributari MobilekQshoyahSoPsnGulf.heyӃooh2͓HbesHAt49Ph 282
ππ!dР8dxH ƣuggq mp,ڈfpicesquerio-p+thAڽwaxurbulpisbiccor*sdar{bxP!ݯamAnv8, hadisapphwrtoge8C-s|@8sgoo1ceaп8MadriIexamplHaw(ememb@chiefbeZstubbPbclYUn n,#LXk7`CiPaAn 18263Ilik.Ɠƹ0grou # ҉fiiXlheavHn8roducqBthPputnxaim۬ntOcrowd0bankoubish0Cdra x-offEngſ~xgg@,ous!j/i;u2fMinnesotaWisHsin;u"xgsP1kljy9;skK1ck0k Il,xtP,orsehemfabrictob,!rythhвQho@oaHcJrgZby erprirreousԡf((R81yPsyaf,Sscarce8 8sǠ{0tribu9zo:*زѾ`nRsWWAtzOr09aa螨deposi=oX8h0e ielf tto@@Xockؖ7Rpoilsfhehase,ereransferredocean-goinghipsndentforeignarkets.peculativepiritslannphrday`henisehl xcargoe0CresciCityouldeoongerecessarbutCclearromouisville (St. LXrpoolHamburgirec0AinypȉcAmericanailor,ommodH׉plIhoadn titbyooa-fighti1eevolutionXaga grePencouragemĉhop1800yakAfull-rigg8 "Clair,ithዻyporkfl,Marietta,hio,ow{oal؋, ncMissppi,jrouȓHavan`J@ohiladelphia.ԑ˃xy`tabexploit—* ucIwhichluckontriHP 284n%mnȆypoetasteraquitenu08republic tru)s8csal:Yse.

ʁgn="!er"kborder="0"ellp@csumy="ITonBr>QTnorXccasexchanPH1sXishupAappaxri-buil8PӔ׾Ҿͩfir9l1er­sorLȬninetii!Undtǿin𲱄rpedo-boDubu serviɻTsuص9@courag`箯xYafpt89ltiٻ(onhdWэZoleaʼAtxticPa8rd(Hor.ty8id ɸthJbpurp2navigma⺸neopaXfhu1yRokw,azcrospEuropirȹHkeoHIbuyrȏsq Y
Pa285 align="center"table)r="0"ellpadding="2spacsummary="RiveresselsZr>25lyetweenouisville,ewrleansndinn8,484ons8r7Nash"/.2,585//?<4Florenc''OO>1,617OO_&PSt.ocalade//001//?.0cotϋ2,016+mps9unclafiedOO"3,20gU/–ߗv>Itay0otatalhs))developmpWihngherecomparyittxreasIsize%iniduhboats.ԡsuvius,builr1814, 480:rn, 160eet28.6beamPdrfrom(8xbiggeslaxwYbularger.N
߁TWWWQ9arcst٬piloQomҒhferred.oar tr3ervifurnisha I0oaucXhoritea-go captaorPiiA@宸n>Page6Lif&ihu`hu #do0obscЪPaenc8ic1ssrXP98-1cPl8#Kbewoطboyh3KcubMcensؽ HuZgbQre(sh-psh轀nЏ(sHetPpp50f#cJvP`tطutes.ƥiȫme y9duc#xcomparaLChPsybl ۂrednbhpR`usxZCoPciophxsop Tarň.e@Pao1m0KBnaȽ!p10oih0le˱bayoux,t-,t,lantationndamlet peitherankf hivallr
Page 288 ππYiҺڳamr$geru!ypeeP#HۏIaiumph!adappili}ervi@ɂd!de0.ͺ$i=egregZar !urآSMcQɉ(H(six!2eX(Qp`discarrBcapac.ɻXsaioҲskilfuloada 8pra8cPdirIqx ep"friif8Ԥbamaћ1iggܮself h@vPP!invpywoopbrpғ,.built|`heavyw,ܿqonaudimYeel)tow\hhennrLmdecalflush)extun0kѬaoIrn.ϸco Hp0P}bre8paddle-elb8orkJdeɿPKe8رfaxs0۞Sa@rbswl Pa,b1z(commmo opulsese-pipCghfab+op$ti*`R9SallyNib8AgiQ)qz90>aoundikeulluff,ollowedyprolongxsigh,hichouleeardarwayyotheensehrestsatorderЁriver.owfo@,l@snppance,oolen loaR(,upportsaloon0ckPmPifteeneetbove:maX1.hbusinessasood 0Ppaceith8Aktrei,eavingarelyhomnoug Hpasserangو-mdoaryfurn(8qpabsgrehsteamxcomdow@oewrns(hacotthntrbout*R8Rˋyowater'sdgS%bale8s9a&sh3oyherselfmonNrm{tiisnowyabi8pouÐhBsmXLpip 0rememb9.t.2, Pax291gaupplacropgett9iork0hnotJdyDhhailds.

N juHfy">A6cargoʛ//XCwo :re8,@Htosmext(onpK-X@DHg boAcall"Texas.cԦu܃gȂׂשaXaXop@ҭwSn袰pPs@rhouВtimpalatial.τȩȮ@sideIlh dooeahy╩a- A.porHusupvotX񮜯8el bӝiʣ9ic dscapeڝCh QKxcidzuakstormsXjag(htܺA:bux`girlrIpurp`grsItpeybuiljns9oclipxrl@BzrЂcydworkjardiscusseXPitN`{Natchezsс/B nһec@jhiep8iisS.rmiHpВc)fun- j.ļB nrab #ch9ric!dayhungPะ38fedi?eiHg؟iceqRmc qinkas0)P!292Fuyew{HerXws,t̹ٹpilot-rQ`honmngl0r\ me`yػ 3@occupyiesquaoxȺ񽰷.ӁKacro :ryP`hpqelfHIdiXؼ@qsalf-sunk8ben Is&m Jtresmnoi8grip(bHì1spP!lEas`haiHama@"urnitFsؾap0 .n''8wob0Qmhjx`0R`22arriHgaudilo8gٴevindick%P騣&be!eAmidshȶaf–ߖ܇esc૧hoaripr0s-oughhx؏1exha@8rٙutvalpY¾`linersilesway,heewsHato8wasoming.

ππAll`isdificebovehuofZ,flimsiestnstruction,uiltpinecantl,iberallyecoratedith roll-sawork,ndavishhcpr]paint8xseHoil.eneaiHwo,our,rixoarurnac`f-ricitch-Ʉ+opennydoraft80g0s.romtopgr`himneys8volicho rsparks,luginflammableP(ZaiYr@.ԑmarvel notcsyeai`quotumjteamabQwxr')gbu`heؔq)apropor8som1dnєap0eilityno@ik̘s90fwindolo`row)cn0wȏ)@aYnPhglasȀlattdxdradiand Page 293
jify">Iy 1840J109ohroniXosfy-n82058 Sh8-usںHp(builYiys ubjѰ8iciphntriArshpH`accntBp@p,soAoa`kxeBoybegunHϲdviP295Page 296 ππB;xH%zmyHAsm8spL8nnthadva "seldomf SmarIy.Ɯk yqǥ*,Pldfș Dtmäd8ltilodprecixdrP뜀ȹkb 8.ȿhHXxoл𤹺ȸo8hauҝz`PickКe1)crewIup1worQcXppqekord!ea8a@Asta.ɋ4uxxaHtҝkof@Ƚsk8jytXeezparthymiddl¾:+tew䦑(i+^8(ixupoipbpБcHoA(4PCiة$.nrougdx&md`;Ģat̆4nXtopZ`-poix!oalfrsnexp:[x tp-w slabs$n(ovoy,zyPeA,LP298
ππSpacup`uquAʽ+Missppiܷ:2.͟whsscribcenIl@09筱?aijword-`ng,@iI)rusPlӰ fusHHurmoil"dicPreye:77777">CEl{c(@;@Оs&bo'cl錄arnoon.Ơ-onwardGburny9-p (ppron)񗑱ʓ;qXnkɻry2r,(glum`xcoal-blasmokaonnasupporაo sa@togeaabrooA ity.Ų(ut-9Iixflag(Sj`-staff񭑽duplicat K(gesѰWUPPcomhwYwithPxnsuemp@aCssorfrparzox3Path #8rTt-pl8BIpasseng!dodg>kYm8ftic,@(`ec蓨Эp-ب!vٿ hav0rub kihWr`0qBktrJkeepphusIpK،Zcarpecbabi1ymaklloh 8r{grpdistrac.rCggv#СHh"wihurry, now$8Уjam$ q,ؕ"tsedȡc* sP8;8fptxceptagueحcmlwindlnPÑhaX8P9x p08&YoёYpeafeb`zRq,`ج!lhollf-nacrew"ppinegro*ɊʑyAsu Xs 'Das'J! wp!'@ed tonimaginablexaltationyhehaosfurmoilndacketatasrivingverybodylsead.‚AisimehurricaneZbereck;psouldlith8ssengers,Zlastpll׆ claallowiine,j0pow-wowseemxdou.nomentrwoflrncamimu0neou؄Chgongȅry, 'AɊXaigoP,leagPashore,',hol@wuadruPeom `excitstragg@8er`ry"boarOЈ\laterlrrayYstage-pbehaun,ach+i@customary(֍В ππ"Naumb@Xslid`hɈ,xeam, w9gaps er@.itizenrowXkÐ'no0o,ordXe[s.ӂfxmqh(elfp,HPyrng1pr8ntlyx`w bPun a؝n茋fla(fl,mokeolYXi0crewfhipnds (usuyBthyegroes))9\f@cHlRvoiceliid(Smouncآ)`:JؤPajHrhъ(uwh8rqnnoHbooX-ituspecxoBdAuzzaP 300Ul 1865\Psc1ѹȪnspor}usZI9yMippi)tribute8Bu(caus(<`xl8`8u:work.Ԕ"Pfierc-fouѶ`pP()chn BFذRmha_YZ0doConfeȲ`tsdΨ10XtΝXM8iȹViburg.vGpFgh@@shlwRatda*fromullxbrRdhPp(Pr˽b@iIeHhȕr (aadv`b00ypuswʉOrnHbu 񃉁p!!b@ai,2r-loggcXabo)Rigole@pʵ x`ene`BottFՠhralaleOhiXqTenyeûX1FWa rxegajfee3vyzpepaptȩkcleHPudPabsİdithIn!Sh ph*-r`Y$' nپd#-hlȻwffrwa 𮩕Spaemp8Hj' nk -hȮ!ownlba v(ogsugarsҟ9l.ϔhau_YquecurxNhS8hQhdeeHȎ5dٵ& mEurop{bo7,𖔹0duc@snµcer ;___[1_ZbupP 302 π2
CHAPTERXgbspdoࢄsѳrlyispegrm gaJoilomܼwoo"H焁ung.Ź`y@rb🸆7Wt,QBedx0rCanadiX(80dumbemoria ππWhePilgrimairsoncludȏ0eirourneY"Englicosouؕ8 Raharxyaskb{thrifJamw+퇑i"F ,s
P 305onؼ` ypifIȎI([bXs)꿰natoPy8buHҞmmonwealth.n6RevolucH!U螗suffPreCtogeZd"ٯ`y xٿ!BrPcruiserXwhor eaХhɾmyuƒjchm+shlopsehd ful4eiz^irargoEm}capta8} 9suggHbe Bt1;ajئѵG)2abheavi𫌶܎NewngFsQsؖȴٝdQlicWVAѿYйPwȘvJo7qimaginclopaSl(odsea,ei D`m1Accor9ȝPlindertookdis%AmcHgi`C0aFdeep-@occlaig)ÔerfirzfZmahibhw.ԵRoCa`nt*FcSpP9g@bbyarhereaterhareffishentut,@oughzpoorpqualitieseshippedoWestndanh)exchang8fougmolasses.gainthisradeordorthevel(somJ)moPoffensiveeasures,roposingillindeed,njuyrannicalhazcrraisaem (nhBr PHousq@Touƒcourwi0 igneopl!hookDYanke(byundredsqu(a!aga@retur8um,QnnglX`oroyl1whichry tleewՑxacoavawasp1boxng 瓈rChibiolonq|"anyunts"moc%CsecondlpPi307 ʄ="cHer"tber="0"ellpad!csummary="FloydɳonRr>O0wXyhtTarr'ȳ@cȧht,_">BwoMar0ddg v>t@i8*pueڽ dbteʝ0Massacpeta@ѾPb@kU0hɿIx෨tow'"ǖcfty`a-gh+scXn(.ǧ(蓐np! kalljasfromPage 308
ππAwar,9rse,efhfPeriexrippl(almestroyed.tadeen uggletwgreXnavHpowerworldaoosIPindepe(n9le withoutycrhzȃchbuilmaint ne.͍`achusetPdi`eequHarm protec(3X,tartly`catYwayadДKP 309Noce`9(sexʿ#;clim)no"ӚtoilNeQeverzHoll,P vF:dexufirmgazEnglere Qr`Ȯ)lmoddX𞫐ȓ+uyhreHoX&mdh;a|o x(9PlAyerJbɯhood.WWWWW">In 1789@di `up̲pAtGo ntHdh՜wcsystem!gɝ{cep-seaw]uX8Xcinudowmidh5laqury, Page 310Page 311 ππBptoYlhnuhtg0ubICDsyd agh8ng38YbIcYell.aisyom$lpW"y3ȁHselp,lQAt$yisnarȂX#dipȃP aspnunrofit8Fɚjȯۃ@xsߑߑэm,ekr؜⼡&mdashIc`ecod lixd 0llownkbordcoyfrom;oufePͼrBaf'sHy"faum,mAgg(eguPi+ quinoxemȔ@.ar`cappxxCф`1wayrthXihNmbiLabo1sPdden ؼq@tanseihadwepoc0Rpbeh׊0neп߿߿߿2߿ٿAinȬy$8intigHscibeaide e:o,khi2birdhmoemкclivshtHjs鐀!threؼ*P'̶'iescaphigՌ;faB,akJanua\.ټ Yge!ownĀϛ9jSsailҩ*acYice8g`vwift-ru ЄGtӪؾϊ˼suclhÀQwHsqlYc8wo浠oms9urfac(ڞ[-(wil{auais`Pealȶ(p7ttoinӶ-roomˇXBkeU+sXttBAs;*|beaڇllee;bhhoX(hiдzdarknp ڔ8dpt`c5schooȴQGeorge8;1nepXqyrPf8r(h pH@Ѕ:!Q px.ȜCbaɔQchjiful8J ππNorh *—whichidirectXeasfapeod\found,iorder,row,aȇ,esternWh;cenЇaIslafdየ8ce0gr0yar؏sXhiftsthk`strewnӑiacribs(pp؃JPage 313 x jHify">Sua(⸨0Ubclx-cjaIr(gW H!yt-likixexceptevidenн r𔌎 dpilHhuȿtjieepf8Ypxstor!roo@SВ)abЬ{8AHlо#zdemoticditn= thatartfherewunksftithskipper.ԁ(galley,ittleox alace,sirectlybIforemastndackioabinre{ishstoringfterpcleanedsaltXiced.owadays,hen"grecitiein`fhours'(ilbah,fauimarketfreshmanyUboats@(irXtchlive—aeepelllw@d+sea-wa,akYy+deck,wartr؋M0fluprovid}"knockdown{Ronxshundredsflapp=(y⒘onfi8desohon.mid`persise@i xsix䐀2enKwhit8sˑȌschooner'surpos`"do Gr Bɓcodmaindraw8mustyten1from,methXhaesuzcoun`ss uelged.

ππٓFmwhooxwCXQq}ulaperavalubeyxploXyuwrё qsooX*ClHuss.uSypicalolife)grow Jceaqsgg(fwinx!wapworld-w(ȏ(isav+pirItak8uplodrama, han P0 316$:;qtegآp"묱asm(Lc$gbble.

ππ躠X:,ýdaPert Htriarch relatiXmetwep+respr@elmhxtimes.heirstteppwardfshermanasoquarter-deck.saptain, Xhadargeresponsibility,ndceive1somewhat}sharecatch,0anyhi`rewxi)riforyposse hipyy hh,uch XIHveescribedsoonecameXwner.nX,erhaps:woulHdPnrwocherRifleetpnayho8 outfitendingboatXFxwh8t (dignbuiltPos)nol`greuh,8iwepafrontȍPfewnglx&md;simpl9hleoun(ackQch)kridge-polproofr{oakq!likpZ'imbitHxIAzeSlawnefR*lod= eɈ dayProsꀢ8Uighttll`t!iupA#long, ilarvdih(QchoL la@otnow nsoxery ytoor0lakryY1;t-lYstsupplickxXducwt@e!;қuepؕʃ1n0ssarPom,al!P Fwelci`draw
Page 318 ππ1bo8Hw(jabswiȴ0ywalk;Hw8Pboa`G}gui;low;ivcati evnk sѾasfrequent0oakiana rleracst(nrheOx0+wHyp0sWebblue-ll-Xy9a8l;hX aiЍunraveaҳ:u(r alulُٱpo8nolefuca@waGeorge`B.ρխ؝Ю#pth@,oa(wn٦omm0ylx*nos)fѯy0g1 upwh128@ dit@e¶cut-@l,bx"xc@l`Xwar"1пo0enѽqconsੴuȩxHv!t񌙱yh 7773971a uffyYv)bues0oAsuppli)i`fuelbun0 eBhhe8r,1nisguȼacsmopcdohحeisFroЯmmemoriaȴ0bAaax#/du henhimӯQp!usuCak{ pHutx[usH—IQen Beav@-flHol wift+Xnsss4awpom:)iW;YrbodydrudgyetБyc`Gloucesterrarblehead,hoadivediswelveearsithoutteastneoyageЁcreditPasn 0sorrytatemongfellowrchinsQa "LittleordaunhroyouldetheompanyfomawyanducklebeFinn.

ππTintimaciesфIvillIstreether@nuho{ocean.shupplantXm*2objecprimHmportanc'sind. smalti}ha(twothoa)pbanks,Ҋlargtowneveralund.ee rew-sxesselsxidway@Xkrivalryyichab؈XpiunityiPexhibition,iAnPe`suthX1schoh cruis perhapflpE(yPneuxmadpndI`eyX zea`captasail@!㊣xc$probablyPp@n(@boМh.harINhofffoaqpeh@seallif#onorXbriactivjournsm,esbxatchfulxѠ!ofts9it:睯">0aggreg @P]ngdklxiehtau|m8P320Tp8XKgsuddenQP)pziftBtog'@rc0r A!aab0Èhiz`eڻ8drQȑ)xɺxrblټdr>.ӵn8qg=wh0lgeQrd㸹bZre.tҨ٬H htUsghythm<r4tcraf0 PX 321 ππyIe sa𣉢lKrvelnan0dꤐuajwhiYddispt{,Ԣ)s8rىke—a(oupZomew! y,ovri雠@neP322
r٦µrOɼalw dpcipprofit-mePTacPvcatHdiP,qendiwsystHex ,8ce` board̜oo@Q٣XD$40)$60И`t beseRllowXreturncj/ȫ!b(⼉.ӫ(tizྀC=oyZȩ@wor:wɴ"ta0uppl v[quipX𽊘aR!xrt]Ǽِ !űyKcau،0efullHi8oXy|3ێ,cŧuKo0day@workca<Hj˖#ci 8ЕѺmِHph wo,rkir{8Яșkhl: dyrcXoe`;ea1e؇K`-R.3^y9mresxsiiٱ1*j!notXxpeXпI ќu ry luthrefivY.eSvalu0go.΄infrؽq›j Awrifty boȆ3wn<Нous)wa`sŞrafX2dأsXenancwغ0ȐxldrtmiqѮZir .n98s谓oHgmai@At౉Xa0 pPotapiiaaradilXäriesavelwaysffordedmpressiillustrationsfhronulebusinorld atJmorrduounddangerccups,lQit.tas ؂e؀ittancegfishermeisk0Pir0thosehodamil`homrawingweeklyrovenderromoutfw`uckyf xMcruiyu"emselith(stpaidaewollarvIPnecardurnn 1799,hpokes${ȁppearbe@eong9ole ҆bgh9petow2Marblehshoܐ̓rag`arn֎)!0 쒸por(,؇087, $483;|8y56;z@$273.ԌxpensЖ`each\dY5ʓathree CnracantH00b8iviqamH{aptai
P324< ="1em"`> ππMackh؋ɕn(h=aZXrodigi DZ whi@goѮiIkeloaɞZgunwaXflusaӪJhaHsedeiraculzH٥ fXsX1Gko,i8sبm`xly;requaank+oggyithabi/Agoahrxkeep#nleeAg@conducHpqtysocilip`ooXVBpictq0'۸3mnotliYenemy,curios`ceifYcarpYd .ӹwhopH,ofgudgeYhuȈr0hohdɡfa؁amilybsomqstxblazy8el0XreםpWWWS5WPpr᥋pf.׬`SqcatcXIۿphos Pt翘|9el$tpctivzPa½խAnhe2awaypot.erhax؋ rfQIVbu^ wu`zXrq(HsiroZxckexqiAhi wXsxЁٳwraintl ckWrdAs9ȋa  chR\cɷBa@drȷpPe-sskipcrzt helm,oX r0x{ger(`chf|ԾKcc nYboWhe@*o wardsrloOOnboaaaun tHl0UȲc`ۤ 3okoYpdecOpbigb,p)y`t"arsarVc𠨰wa~͍ Q nsPzghheaternd0vigorousugsft8arsmen.nsnan`andxhrowingvTseineyrmsfultQelЂcampaignoloboat dory,achprry"e!net,oxkecircuitschool,envelop0su qpossiblefolY.erhaps tim`sromwenty RirPnersilleCtakIJataskheiorcheslazphelmhout͌‡ȅЋphos resc@praypAairmQVpickway—aelicskipp8wisXkeep)near8h(p,et0stupneir؈hngrivaWolyxtOyco af!Page 326 ππ<@l="jXify">Wh lowIdra toge*07untilp`nclosedavmarAcah(gb0dowsid".ԦxmaHretrad,gl웗iCePxsituJwouldarceɀPiZy.ϧ؅np'sc0clhfirmlthlBdb,p9tHX%@owhiliQf HferiڬafalgXtseare,uddlА4sh 2,$e!\$rai( shinY1ndreh0ڰ3mlPbHJhoga/l`lapprepXs[iaxrzipq`greXor@fA ,YswuR0xv򙂮,midpHchpѐezPirPri躁aHi xvoopAY3.Yo-0ve-oh ADixڒ@oih8j(ǹ迸Hl\ol9hur¾in[udr@w nny0ad9F0afi-sh! crH|crewunisWxhgaPranoI.oHfmok@SszKig#o8ݞ9Uut(ak/hթNrouqEPbbumpdt88os0oeaxmIb`dd༸pecu bankqs.Page 327
ππ<șpn="justify">Whnear!&md(;ti)hau2+ y!wicedXr ip򿐭erruptXi (!Y"зpap.oPretty" i `a آm.¸}RܼrpnӷequIѣzsu葷:ʍx!Zgafurac YR.;keel ,$PsquoxEwhiQ0bυʅaSPH;`o,gis.firsdextp9 5f8[dowxrow~erŵ胦[``umbrmX𗤅!ac8thentrailsndhrows8eishntoarrelfrine.yongractisemenecomxceedingly`pertXwork,brivalrymQgangseeppaceallp Xhighestossibl8o8.0ugh n@tYyntieecksleanedqslimithloodcales.ԇ;,mselveshrhastly,smeBfrom#o0oacke@.ƁziH@,u(CXroll1walowdJold[freh`ss)mptyesidXUlhPxhce(T,lung-jkXktcaqitt pitMius瓀AˆψϑLЊ1epidaterpasaabout;npat duPg Page 328
߁L justify">,wev@caolehnb diHtak0th г'Pa蘉stru{0oT8tHca`xtuclamۨLp"porgi@soȸhgej: n'sea@hicsinkDdepth li񆿆urf9ighEyerh0wonڥgɿ`(k88syuȽItri3PchtnpX @chaf.ӬؼIb˿bapbipdthusupȨzsnavidity@aHinxYPxɥBH Nordh2rePisclQIaly A9crib2h@ȍݿYq[@rap :WWGG">AtdDIXթ ybHthourȳI ;iȫzshreezlowfretfuCߍrig.oznc@I HceiأbPea'gup'XwIti!sker`clou8e (prg=raiInYwea`y*esؙڿfoImb ss𻑟excedayzo郠QPgm3`p Ȏp#oYei2@ae(Ijigs (echnP螴Zpewpm)Ml:xusQo'ckur`o0tabPbun soqg`leep+d(ئi"(-bؚȎ9 updyI'ԡ' ornaeeXtarȚproprietj#YP!'PQ330viRCnti 8Chyffectfnockingelatownnyerthgain.fterecoverasuchonsciousnessisecharyoppiateposition,olluJbed,erkavagely p1oots,ndnatchqup cappea-jacket,akeush atheHmpan-way,upwhi@InȅfaȈ+haste(npinЂholdorstrike-barrel.

ππ"AnowJmsaisH,jibڅVtЌythrow)bait.t"otetuiЃhbhwearrnsoԈrouusȐolrizzlkehornbnmistakabun8xtpahalfleewiourorh0npewiswe00home.ԏskipper,Hwe,h`li 2rɃanirclimXpsest Hdaibbe$sufficien0 seal*doommOOOOOOOt;'rbyʞX!'ohauPb`—')IPHyouP!ӊ'pim|noaha,,قҠ,!'GGGGGEWqfirmpmXnarmXndicat*@sencef, ybodymadПa.igysid@pl(0w@pye8rmKHeHe0fuXlengye!,ee nx9Ȥ{#GGGGGShԙ]"`sвpass PflyIxl,'Py ;longPggg//ggYeI've~ns>hnexnE  knᠳKf+I[A聱yǵϵ;Z-z-zip()yugQdxpoٜpuاu5὘c
P331Page 332
ππ"'HXo!ׇ?'0gonEynH0eltxgerly抰aite,Ht0te@nibbl‹ceptix0%ameago9aiIruȔxboard,țdisappeȓ@opleteHBhXleftv0XnextYџ8emplitthaninalalhYAYohosߏߏ1nowSookbous—艉8Hؘ'`uc聏aIѡ0bbn0brokihorr(y#Q`st0 #1;qexaeӦȝ QoieXBg"sensHĭIpetualragg2fmcrof'PrRkiQI!șʩ`oybiglowtoo!'boXJclИȇ|X㰘tе eвBy-@-x8a Yj[!oiЯqjibruҗway,p@a@w`rthWhinQ,ak rgoodD{ hafsgeneralli(ai0P 333
ρϿǾT8AuQm՚up#BerঁЋrc༡hINewflBankxzardXݽtinfogLwجepAthticZaysowQiTt𐩨Jh8rk9Zaʆhw)rmȹXedesˁjݟeoenYhA!1rxhhadopPAmc״/)YQury.Ϭpl!,@ppor|floasl@ta4麚chox@Fitxphumysh`baiفةɄbfYerval aphgopu֤CbsPQrey@h}qf8eeturnsithisoadohechooner—if canind`r.

ππThat perilverresentmsfkennBdory$zang@losingg`.ρBankseaalwaysunnmoderatelygh,ᇠgrehsurges,AnCcleatywillptHshut |iesrom:visilookP.Ԍwcurrx8eaoweepittlesh-boa8aough᎞fiverix)ho興bmkehguardhicken@sailaariularQplanneincludPȓ mP@z,e(qohapphn|؁ҐsAnViwatchfulness.ruslowb,hfb-hoars0og-horn,rdQrc…IsntЕw$t und.ometimYcps9a pe,ripp,xAurtaimoXimetrab3bla`J,4rʋno98zb2@bolbe{soyiousdistortedQjdifficulwaq0tx".ΐwhosx e ҜquitQagHpaqu)Wse鋐owba gpleerIXrecǐyiHplexityskڏextreme.ɢ nstahadup ocea0eaveR8ntsol8da=lىkA2مxfin XbusyNt(BhliIudlHob0@H[cYˠtrf
Pa335  ׈׈шjustify">Ordinay)shor1riftztheelplessolksnishingelhentruckyliner.ԁkeprowutsighthroughlankIandoutakrame,tdi0veredortion8fhullreoPxo@arboardo,inefowhiteamaadfromake=deoymtyeghoulaHbodiPslicinwa0(neatls҅@tt f;m@asleepheirunbedecapitated,r!8fismzggHg\ithxmleghornf.@ag`hryes thw lmostiraculousN)wn)(colh( zCtopschoopZteampcarxbroarsafety, lZ8partsurnY`dead,oz,tlsuddengrYcra𘘕imbKleftawide-eya1ayeappɉ0D9erthP`nPnt)solhbx^stunYsomXlbiwoo0whoP0uncci,PМpˍhungry,tiyivprec)a8 chaa`doءadraggʟzlifBserҚrdhumanitwyX9ruelty.

ππFew1mڃuaorkmexayinvo(physicpsuffexs`ܝجZtrawls.nd𩢓!ircum1ca{Yky ar*mo𣸥؄Xmaw`Ps`dumus-tr,rve- z.Э1uplAmزHtcbotto8bigjumfApeedyAdЯmahnoas0asxqɶK Qloqhpw(qris@P0Yrinflammayhetism.¸Page 337 $d-Ἢ ixeetsm(q0lengtha2htnd.ř0õ ,؀Ж1ʌidr؄a3e@at)oPd:ubsaPharre`)w)a؝BbayЈd@jGcXfnanopubzypu8quick讙snarbewww??wwp|2ind ѢHPupio'clocAf9mpenjoyȯ-mokpprepapion4g+A8scس硨ʹ0xap)(c଑"_firڈIlo yle.ϱH,jumpi"Ht)dhim;HIe/Pimself:&!paJrin(:pova.׳ځpostɒQcIof(grнCboP$"ra#.ƍQ@rewaeQbuoycoulȏP ͂xnǁ񨒨tyоHmsJ#2Ʉ(G!P(Ͽnkfottom$)droH )rapid8fneaseachedtzti`toheextA,pusakingiofrawlenpousandightundrfeetong,ithe hookstt".fterscnhhadailons*coursexfewyardseaptain@s0fxeco8dory2ttlear؄#thirsotilfiveoatserHsett!gear parelo q.ׄispracticypresenta
Page 338ms nɁ}*it."

Tyyalef u@npicupiXian(rnbuoyڎ rЖ*taybpkwork!hauxgiqbegun:凲׈ׇ߇߇ي{AmaderaeؘsirPspeД\grE.Ϟ4Pm XaRpul䊋, qroPr—aroxdHodwhe8ipdiame.ԗen+!si(Yզ Q+vyncessariȏqlow䔁ٞtak(! ԁxppXaffckb٦@ngXa m£Щargsharplay(Kɉrequ`uslr {decionZwoulreeself(t歊urfac`bermanremarkab(derit {grab!sڴ1vipmfo08ȅswf#b*BqalwayXenceri8iseemڛ`ٷdsCoaddoذ,1C,umer8hpugg<.e!ZAۦrimm,phiPexce `fd;xBalx8xn$uskGغ@bPak軳uls-laskaton(PalmoٿaiimigghimlؓnotXzubiquit8|HmuArbpSȨZuch-ab sculpin.ΐ*uiP339 ππ"THEIVESF iFISHERS///z AXspreairHnvȔe,P 340 ππNowgaHcusqeatucagetfixobra8tؔptorDoubtl wqhasoa ܎Ȏith(v!actsom@nkn manmmwHobserre`Yi.Ǖ`anunder*muluRonloodȁHadЉIro`keubexploit,qnP 343P( 344News,September 17, 16,isise: ".yertueanc Ass0lyFirstear!HMajesty'seign,oruilding & int aightousepaGreatrHt(calledeacIsland) EntraAIHarbordtorevlossLivesEstatpSubjects;saidhbeen⇐t;nd FrydayahQ14thur#kindP;willery ful抐x0lsooutdomQowwn|Mershp8ReceImp,neenyxTQnwards,ano@rOutexcoS,`orejTwohHs @irl₀.FВ,oodloop`2c.veׂb`.

ππWhAUnit`SGonmed iadoptiContu1789,w) Z htc ,amely,ortsmh,.H.ˡ\ģ!abp;ueynPlyj,s@Bd0` NuckehTailR.ISyok;apenlop|DelxCharlorr@,.C.Ԩ`Pacificcourse詰dark.oo(IulfaMexichoug1hansi8ablhippxw!her.Ϥmuldth gmspȇ oh38u1;banknavigzra2pathXsTerior o`n edXPage 345exCio*P8.Ųsixtadhri Rחחח6יc# `sp)?A4mԔenxerAgarrysupplreXȾsdowurre$s.cerhlimgc`ex="00092"MINOT'SEDGEIGHT" 8l/>
yqpnY ao ȔubmergXf,htyaNpro`mLrequ`sxtraorqut!echnicski8Қز1asoluhraiYQd!9e4fAmoZowlPa(2)sxcahpy翨itubuctuؿKshɼsl`cXmKdefsawPwavxdemsHolnȀ0mЈ×3cs1ur.any'0bQbuilt( poм,ص@oY0w MihLedgzbBH0Harb1meXb ktypeߛߖaCmH mou` BaagmYoll~tshoHgicahundryrockb迒9eȜȥk ݶh*Ѓ`[P,Yevr k1crashnc uaX齘irIheرpwar JerfirAcomplD48yconP,صx`-ironilesxtendingiveeetntoheock.ԀPskeletstructureapected offerittlurfaceIshPwaves,nyroughwhicht builtqelyeembn:Presistyombinforqi8Ywater;prilap1851llhawayDworeeperwhohptJlamp`rnIuntȊtowfellenit.̄pti,tch 0 Cohasse:reeʄhear;toll9,lhouse
Page 347 ππn,Aimeshiptuggitsbwarxhparomi'sedge.ldosians8Hrhmbe9laNewfoundhdogtv ip!ur!oapiouplunseaswimboubark,ׂЛZYwtrew1ga@rhisawdeKϞberikzdayrea.…px'seremporaryacoa)needQmH penchar ت.to(if{npopulocehh@ʤa"Hbegu`(scie9devispAcco(nglбpє pxI1onےJegun5 promȭ؋dgn-oasy藠famEddy㲁SkerryvɨkHtri`hڕu`Pnņish Z@XpؒaB @eyhtidȓ#pߞ،d*lqalȂ0D00$ywos{onxK1!S1NomiА[l2sixnths irSuxmitYexac130 rs';seS157철X;,'21nutess*roarurfȪ_aownPlftwo,&(@;br׼׼׼8׾oclɱx sframe Banch0 solid@pVsezupaav1dnoras*itߴਹsw9pir`2`*zgyoubanɣuxty툩Rstfaհѽjruthpp*pڨKagleeav8ad(iXt8rq+g*Coht.xaJsh0s8Acarʹhu^9Hrt-trynecesssN4AaPuplq.ɠ[m˰aXeta wPrecq,ᢲPapmschi؁]fooҵm`S8complep soɧ@lsY*Bcr؜cgranit J`)m@hBHoffonfirC,Tؼ̉_ʫUH paЈ;idsee(`ca((foam:oyea.׶ҏP1ö&SyAcQhirhHw qu9yaiP޽  `Ҫp^boatsC@tiXAtyadiHi ππOPkeeperssistantsuarae ht Page 349Page 351 ππT(Sphacleғ៊,3҆MinotLedgAsimpZmassi@onrЖ+0iapvdgcsxpꢨvevytrro2rA.truc`@nqaypbbulGulf"screw-*hОkelet)`e9iУ shbђeb@Qb1ocean4ȅnH♂(bug-BȦXHar=iɪxpHІRo"fama@9 x0co.ƩɢːHPn遗`Sa(thܰc@ yAy@n`rbùilɭbecarcelysavAh)8)de aYX8iength,hapisAalacixäYaп9rockseemdibYžxwephgtt`h𴥽2!casualYer Qggbbr)2kilfulR|grbe豨tPb0ٗTillamookcPn;8h]Columbiaҥ`trik2ll8r˗tnoshՌtumultubHpd𠉦3qusupp̬hoHchc^m`cipis]4s)sI.esdc ws(on[aȻyaskɣboxert@.Ӌxteeɿ9i(oi\o٬i`acal(ea0H7!mfirإx@:wp`)g`OydrowatteX.nȂ8efqsniHasucsؤ9roa8pٟyHd0:Prolong𮐽a,timb0hu0bolz䣹{begblasawasis/@`Bs6ne8^.Ȼty+ab[)¦yz1rwh{or rȹI8)ҘɂYjbo҈kHti moIxsannnglisarh}ie1pĹk!,cRdAlifSarJ۩YP𙘹!icPxdAns (dl)Phopwarcdoha0(t%shipDbxcZposicIitwso(Page 353 ππMore鄠nHlifPhous8stbopZships,whi!Unitedtatesopnmexnowasorty-fivmission.Ԃipregpbyw HmerelyPmakeXft,0symXbehya t a`uryr(orkhoalsdefs8 thu0{mpoblPonstruc8ebӈ0PoavigaymayybuteraWhicolَ$Ռ;notfavwit{L7B,caXydiuke HsecȄ,likч]0vereakromiyoIdr`waxle`8tnedkeepersuff8allrdisy8sailor's+i+x`enjoyn$nxltfdomRtuchdJr|suYoun螠 trollAra ҝuppHinsupta7P`Yožń%ojui٤Q8geqa{familcorAfewIpytormIdeckKsg cabpp;GAXchehpteadbeZp{firm,qp)mas9gprfRtkïyxvI>nh xekDujloxwee@‰Heas`h!esyң+iiPlet覘 orѫsh@off i;a`serslxl dڦse{0<8___354_ocen:mbyZң\gla@19qpHrooز ottglfieldacrxh___er aref="$00093imgXcex="4"q="WHISTLINGUOY"itlH/br/> jify">LHesqu oþ4bhumieȋHQbuohvari@<ߵۼǭ"aplacuPauvis.et(m!"safeºrankȿhAXy(ث qhiC(tuQpathqo rbors;cRbephm!hiswarmb{menaPh@owsunkhw0ksoursciencinvivxenihHhdrawnSeҰôhT8yexcQ.t񟣹pclricLѥxubmЇy礰0@osfin`h0fm)8Ho༩@tr r,har--urnfulJ dXُӦtoouasacomo vaRmphsb wwwt5waبd'"9i)flnesit8xprovidBvy߆Veqachؾo tuAhirty-twoepId 𾊳࿨raZdoh24!ټ@x9fji+B!AK»c` pon,ivbLOidmitt2ȓ7G771Sipurpoɋհw|0@Xge-dȽ钬W.eryqqps@09)barodigimpraffXl iways.ensantern,angingromhermfostightreneet耐,ndept edyomebor`ertpcq$160year,0cksicualityhouseoweabov0ungrea,utsecazheraarlywoXsuchsnurhallowcrookriverweXnishippdoarryqtrade9milliogivemploymenten.

ππ

Chiemosailors'HfeguarЀerviceerfoUni)Statesevenueut(TЂ] ikzoystem,asstablish(x8hortafAHaat؅adopACtitu!.ɏPprimapurؗ8cY oid:ence򂔇lawsuppressmugglPsJh#aran,Treasu8DepartaXdirecIundLchargQSecretwrx+ysp0?hxdifuncQi0w 3ciadjnavy:,b0 aa ߔm.iracyGulf MexicoPa356Au@AԬqHArXwZen8cem4modusndixrePuphG tri9~UniyStpte u,pro(m(eAex^ur-blThƪlfisyŠxel자sa(slapɊ`P@I$moolP𷰣Llo8civildxn'arfٞdumb̖eo8X򹨂б!suL oSw\ؕhomu9ouloodsty0NhPicPupdɠoࣰYpl*IunHc0uI, whollynnimalood,indingtceheirivelihpdsportn!hase,ressfurszskins,dechgmselvesitheaPr0buteveraZsuch0roadspwilAlifesoffectrXhYflocks.ivilizednamehisiflHZhot-guyeagernkil1rsakef{cupidity,hilxhimignoreree-seasoseek2immaterofitDmightccrueromig, h!oughyrebyparticularmyHbeenddxtinct.n臹hptyeaft؇jomRogresnlabugbuffaloahisapped.Ԓ(prairiiickdousescarc`m remoregi.fJx@w,ielXour(llttstp8castri؉.wgo, ؅tnealN@hacificce9BerYSea(arpstg@lxbeautifulitn 8hunx hoѠxBЙew9y`sks`laٞњXlef0Reavylubs.P 358P 360 justify">Ԗmmidwbetwmer!ĪEnzyalmo@(engЖr uffԸadvȿbmQpjoy.xli!fyoJk "retirlwar@gainiwh3lA,repyunRXCA,Pdeem@viplag Pt cnrolmanAwaitor,b8rɻaemporapshif$nPeeHssuTw`)himPoPowhiquฑslowѧsmh0eʄ{apx$2500`year—so)re"klifxrduouabIڎu cޯѾо il,ʑȒZ@h1X8)bǦnҋQHpeneiHunsccurCwؘco(JT In ɽUXΣOLhmoڸhundv8sdy8pviytakiin҇@|hoP0sehn9RdangerypoyutYetٜxi zfamibcaYX*m؎OOKabkwBspublX᠀м!admiDDsx` $&o9 yؐY ateastsheecordsf Page 362 ππToeryonsiderableegreey-ȄIservUnitedtatesoutgrowthrevenurine. sojournery*wr,3sh@ei80cerk8trimxtt?8 XaamiliarhX3summpYureekenhtapd:exhibirДc腴urf.ɒ[holiday8d 5uxeohiefknow,utsVwwrrom9 ͑ㄘn 1901 PgrpseɎȘhgiaib377xkshipOfpxyjxyaluО`$7,354,000X d $6,405,035orthZ93,792uʂildea\979Hhe 9fig@)l蚨onxǗȋ ϑ;8bl8Knearphharbor'sputh˔inulbP]cruisunyachؕm[ilboath(rel@nnuqL 6jattracp xono117chscues?????9HaǣriginXai0ng!czNewʢesa 񭺣cenʊftHBC1839ײXiam.elly(:j,٩pbasopnor,0ood}beH"agynagempxpcAPri "CtЯ` ftalThATpQ0Ptruckl`(sXbrepfoX᳐hr*lqPfxaim1Page 363b0$+elev"1clyf.hc( TwroxMe蛀cr02y,r c`quickIpmy @ ¢unhtum`Bifulȁthq,hcro8Jcm`t aJ8Xan0baOhausirZugМi (f.ɿ`tuaexmpiTKar yockea X|XРbu]bY2ycul·com()uc`9owu8art9*cnadjwsnfѝo!geZ)뫈8 y ipurp.úwww??ww">SbPR(fio c9CHhدwork( iٻxu0ihltle)aiWTys@ xoi٘ZayН)1848ysecuIir(appropserviccZZcoѾ8ʵey.iʭ suex1901 ablishemb@270ptlac,acifI k4ꨀ $1,640,000.ƺpmany:Tb@hr)ue878]mparbaumXchiefǂǨ({rpatts Page 364
߂߂߂܆ justify"> methodsforklife-savingeavobeamiliar,artlycausetachcurrIexpositionlateears,Gsrepretedyodelta!ndahiwPai`throughloperRshootaHnverstrhship,Ⅹ3saȓ$breeches-buoy ܉c!non-sinkablself-r:urf-boat.2QAtlantico ;tkdiibuqth(prac؈e(olJSyookoat(ispnuuHr trol9watchfu@ries.Κay,weahrporm$renȑɂmsetuđ4,lk9dowĒkeep harpyP1anyes offx.idwaytwAyetnKreturoAH@In5!iiɛi1pitcyprplofly(haP(zen, ga utuliknSan'ass؞s@nedeeds hap2(myhu8avbKmyhiscom(ckdangJ`putxdef:`oiPirP0enrccasded؋үor{xhowHcoХhmagHXoismˠH(ilufa@Xϵϯ??8AseafaZ@ahceHtimAYaṋrxx(%PtXP p@PAm cphtnottίY.ŗ)ypowainroa HambeȤ!jobAild-jpicesqusRˡdXxoP(er;(uxPJlɭY¤2naЮ weled.լ*aw ynHmb(apsHm£ېnn@@dox;  blpQregularfe`iĭЫ0aBPp(i hh@Xouj+anPPS3acquhcit8Perl,zgrut㕯໣boyAstudizsJmbigge8ship%ظ[toubottomp$`iefBrbodZdulrberiumphnѠp rboamŠ,dyؠof@٤!C`sqyCalbetweAs!׾׾׾6׾ьQ`nf-zuȒinfretXcruiЭIsӛIsloyQwa؅gamTaٲ\eraێŨŕ(,gtyxtamq;8(zܬѿummA`$fȃ*ajPTe(wri؈\usYeck act싲nupi1838yty-sixsb[Ғago1d*Ƀr`lyeaᵆўmmeh۸“decsru8; .׽FcexHH!ryd:"8orrWEuropaڿSyookheiraptainsecamenwillingolowpiveundredilesromeworkatakeilot.heyant9drthvesselorveryitfpethatsnm, xleasttileport0Fireslanderoats,cea`rampoo,ookithisfavPonhipp$autsea,Xmnly idlard8(s m h qharbwasPacheS؉ alyetweeksawaycooperation.tebuilser aZ-,hicheepposiQuhsides nduppliȄeight-fleeQcruis(H(xbeQa(wcoa.‹thchange<="1em"> ////y ify">ProfȐ rQnospȣIp@Aћ4imagilsب١I.Ȏ`rawgulpsa0y,Ht2fegraby span>k '''#8'QjbbiequivXg.µw e͐m+Xpeld tpNay`workmccn̨fcHh,hקA("4veunX:#-Jhja9{۟nkƅTkep0uDadmikapn@eyhи^谪dvXurou uaX.ewccupatP8aapar2'meqfhԆaguardhemselvesoellgainstangerfver-competition.elessjearningsypilotsreotreat.hey Hend9operaruleldyed,Xamooualls1e irewardsreeandollaryȁHhighnfor؆"ai outaNeworkarbor, pnx@Xdecpsaships owig)fewerX`can btlP ؇wiXlnyime,Rlemenbluck `eXinHimomuchgambA.ƇweeksmaatHonlymz, Awor-ZbefYD,}geughxutbo:z@carriedw{six'oyagdurwhiX91iyhBؔ,ikaypiPQٕadurH8d!accust`k.

ππSsisafegumo(nciencorganizhavProvidX tpursualhaz.͓9pIcoȍ ouljenum)edervidwHau,y衩indIrmJgio08(գLeut8ty P 369
ππBuKromancYh9lways Hround0Ocharac,ℸlmprovideH㏹suppxduniqu؁HityPvXA(degrereoadvantage.ԏQpeoțɘganiz*8Zid, xtec[guid1ospitalcmillnessylu؇Z$6ؘzold di(.e(P371m@desPonȽ:Vraftx@cRfpɒtwuteamsXYLond8rnogfxxGakHPfic(xi¼I5el"-zehamР777B@Osrlif(?"quY𦐠Pns .op1methooffloppjoook2ombiusaи(m(warhorhsX"wnZpk5PwhiQCve CrhielLowЏfellݥ6›succesرJHب`meconom(Ir质aftc1or1Bk0a׹Sttankerx1]eagȶ@kariv+chtqabx luxefl8л)ppliv8sAa/Ymanipulazm hirroXdi(0beH8ouhntroocew.ן92kba(d;pt麸8>YaHscinaqyt Hr)(@#ccor on+voyhHqtr)jtw ʦregularityndheonotonyfleeping-car'sripsetweenhicagoSanrancisco.ntilseonditionshallateriPyhange,resittle8kelihooatseaiagainttractesss,nergetic,rambusoungmcans.ͅtyp(!weaveescribed 0earlierIpsHbooko pdop0fxforev k`!msubordin`os ,jetorwhimsdomi8҄mployQcorpor.enhrist,sortmwhoxcameirst̄,edmiralEngl(aid:

align="cenp"tabЇer="0"ellpad(gspacsummary="Mi(rwnZr>"_Xusinn*`,A'co8beulȒPerX ukfront荑$rthrYi newvelopt.
+W"2W1h3T{NotesoojGHTART:ULLICENSE¶ဪ =PLEApREADXISEFOREOUISTRIBRՂWORKԘ?:uxmoFfree׏W5b)`Wbi (8yororkssociatednnya ithhehrase "Projectutenberg"),ougreeoomplalltermsfZFuGD-tmicen0(available isixornlinet )
.ӆion 1.eneralԅUandedistributingmlronicorksA.yeadus partψSindicH(have,nderst,acceptdBintelAu0property (trademark/copyright)ment.f:doo8bidey__+musteQ=dturndeoc0ie_WU8rossessppaif btain*1y ssz쑪bo@(hfromXi0wh膶نaset؝aphE.8.B. )gerFtnxus{oon7LpeopqhhGG/דTh!(wyngPcbmo/even ouɨfAזSp71.ClowwqlX gëg'Λfolw%2helpeserffu'ߦ܇Fh/mXaryrchiFQa(""qPGLAFownIЭjF!cLW.earxUvidƂ*Ipub8m aeanÙaseii)lYlna,'??ϴ)pecifi{/:7_2=,iew8Vbl³! ,ogt@Iws8煦reasblOKbǘǏrh-:p8 oyf 20%groxfq18 ycalculubimedal dhS~kapplictaxes.ԵA^ownGǻtrade, hPedxsY`G׾׾ѾArchFa.ҋmsb8aih60ayollo hnhi[e@legalYi $);iod(turnXs0ldclear04u`IQ?_???Y)/QS94, "InbɌ0W"ref (moneb*a{wrxPe-mail)534receipps/doM'OOM䅓x О =physpldiumzconu؟Q{?//.,ccordanc_F.3Iҵ󷺙 lacey\i@fy47spXCɝd975k طs٤ 2fWwWIfsaﱇUupAdiffРX eʆnt,2 obtainermission pwritingromothherojectutenbergiteraryrchiveoundat9andichaelart,"ownerfrg-tmrademark.ontasetorȅS3elow. 1.F+1.volunteers"employeesxpeconsidblef9o ntify,o pyrighteseanranscribeproofreaPublicmiworksAcJrcoll.espass,7m偱ronr,1mediumxhyaytored,z8"Defs,"u@abutotimo,coXeteaaccurahorrrupt a'p2error񊟁8i8uali(tyfremd`damagdiskO3mprirucod0thaY9anQJbyourquips2.IMITEDARRANTY,ISCLAIMERFAMAGES -xcex"RfeplacʉRefp"dparagraph23ללללҜOOלONany8tPuJag74 thigre`claimllabili@X:`costisludylegHf`.OUGREEHATzHAVEOEMEDIXFOREGLIGENCE,TRICTPABILIBREACH CONTRAEXCEPT`OSEROVID`INAR8APH3THE(UNDATION,DEMARKWNER,ND YyBUTTHIS+MENTILLTE"LOJI0UALRECT,U(SEQUI PUNITIXINCHNTALEVENF G9ICpFzPOSSISU۬È(URIGHTREPLAC+REFHIfove*7win 90`ys9receivai(!monh(ifq)paidZi(ynZa"@lan8IhsHTۘ".݀hysic͘ImusyturN.ԄX٧!v@d22)wɲbWa9lieuъ/'$/۠mhoog!a@ppxunEσσȅڼylso_UоqoPfurziAoixrobleY4. 5G$sep??*ޫ$'AS-IS,'THOR]Y!K,hPRESMPLIEPLUDING 2 OQCH=RITNJ`PURH5.omtatdo how曐certa0impxdarratexpsi؊ҝہypfro‹ߤնiolŽZawrpHca׸ѾWsh bepXmakmaxim/ȒXaXinvalPunenHceA"sDž~Yvo rhinYνX6MYYin(nifyholsFoЫ¢ trai!wner,+eoy\JȣfrojGu`berg-tmsaccordanc8c7Y* voluassoci@dumo£0tribuuׄ׸,armless™@,,stظ0ensein"legfearidit𸩸pt0dfo BhicٺPcauoccur: (a)g'', (b)ИpDmodifАd9dPkH׎דZ(cD⤀!2Pm+abYMisǒm9synonymouhfAk'Ksad4w8sPecomprs includingbsolete,ld,iddle-agedndewomputers.txistsecausefhefforxhundredbvolunterdonationsromeoplenllalk life.ց߄Ifinancialupp`orovide?sithassHe yPeisriticHreach9ProjectLJHnberg-tm'soalensurtha`ll@ Premafreelyvailabpenerh8In 2001,rgiHaryrveoxeatecurpermanentutI#OToearnobouggghowourcanelp,eӊs 34шeb http://www.g.org/fais/pglaf. 3@m$GGGT׍׍֔afit 501(c)(3)duccorȏcPaniz0per"law tMiAsippigraaxXemptbuyRIryRevenurvicEINHepntif"numh64-6221541.ontribuޚgggad tiDfu`ex8tritU.S.fb rxGFpcipofإXo)t 4557elDrp.airbanks,K, 99712., ਷mployee 0sh!hrough @ehKI1u@esτ809άh 1500est,altakeity,T 84116, (801) 596-1887,p@k.ŀc8aliPrupxeib! sڋb*/}Fadd(O:BGregoPB.ewChiefxptٸDiribXby74DV___`penup nouX٬qwspீublic/arh!mifY1Lpdoʾwor ]dPпpmeduccPZ\Isrra fquipm需ludɳ.anyma($1$5,000) particularimatȿWTIcRePplyAJt charx r¸oY50ӯFUn(dӀѢ`ian rqreyˑYunic@t8ٞPsrjs,uchx mfQ!eekeepوs.Ⱦsop7 hȾ8ae8fihoENDONATIONSdePmyŷ`ωYyipǣǣfra ng/hiPܛ߾ੱfrommrێthknownoPohibgpBun7oxsop ͸ ѯI)Ihrأ)grؼyLedK/mi9cthtҤئ:H1ǘǿ⿣loswampء:ff.lheckWس@currho (rM︈ray _onyYrey+,㖚:ggN5enlAlronrof0Miel H@Aorigi(׸gPabJwuld󫈵A`.rHirtyearؽducعʶ7xBoo3noxnet"volux`ogb9ofʘ]sevBpr@辙,2wh*!sнDomain the.S.nlessopyrightoticesHcluded.hus,eoecarilyeepBookHmplianwithnyarularXperdition.ach냋Psubdirectoryfbsameumbas's,teseveralormateingl)vanillaSCII,rPed (zipped),TMLdrs.orɁ(EDITIONS oureoldiletak߀n etexЇ qeUldJrVERS bao8athrHrednew?ceiviU8_bMosteopHst@tWebixwhi hPGarfacility: ׀׀ܕ!pboutrojǂ-tm,owoHdonڒȯ raXAiveound,ehelproduȐyg, scribolslet@k8[Pp(priorN2003ELOW #10pd9EipFirPle Pe.fouantdownloaX$ly, phansregRsymmaytzfollowaddju&byy.ggga/s/06/הGGB(Or 05, 04 02`1 99 8@7`6@9@99@"1 90)ώʉ8获'OdiffePty{iaϡY(noong1p(QW(cdiç})gߦmadepidigicsponallX9laiIͪ.XXxa1D10234ou`f٧: //1/0/2/3/Hn24689W2/4/6/8/A8lᣈmetho(fHcP {O/GUTINDEX.ALL?ga***ND:ULLICENSE dGIF89as'.5(-5(.8'07(06+3<.8>27=08>-6@.8A07@4H8>F8>I6@F6@I9@F;BL>HN6FQ7IQ>FP>HQ=MY>P[@DNAHNAFQBJSENXILUINXFPVFQYJQVJS[MX^POWPQWQT]QY^XY^DUaGXbMV`MYaK^jN_pRV`R\cT^hY\dY^hL`gNajLbqTaeUbiVhnYbfZdk\imTerUisUlx[fp]kq\mx^pu\q{`afadlajnhfliinafpblrdnxjmtjnxdqtesyfx|jrvjtzhxwkz|posrw|[t^{eveyc}lvl{k~rvs|t~y}y~nqgnkaflostvvz|xzstu||zvu~}|u}øì˵ķȼĽɾǾ˿!!MBPWڥڥڥۥEEDDDDDDDDDDDD22222222222222222222222222+,s bFP*UHjT%I#Gحq]HrKAz>} 'i9% C\:RFYׅsa]FMSL~,Y s,Rw mC~!-u!߂ɧaD]l08Љхz$GE1lt"Ex^qp0\B0iʡ}'va}!Gz:8nfaV8({]<ђKCLG" P /44̰C~O@ /@L0 > i .\: #k:ZJ.l%:3:lGCZmGV;|MD/ٗ_EFb6G*; }Gs&zpJR'VX>t\^g-!^'yCM4FM7`Y2/:wNUҩ'}կ _( IB_'@A Q@̠+(8 >D&&lJ<#2\ 3b`287iWZÚgNIjo3D&Ёt@?am>֤Uc0[ך '|8"NL;)U;^e=Cc amt#G7 cX(9aF(G;&zG=NG<6]w|ZԚG;U՝52O;F9rCK8\`6~ 8A &@Ha Xõu-  @!t@9DBxxw ~>LC88AE3݇;J>qp|;q$ xA."x@Mss|Z'OjM->ꑏ{6=1}yAt|G9;bKDb rXCŝH| Q0~t{-5 wh ^p&A%-n鑘B"1w[>qbK )6!*yB܉Ձq ZFa-pYaԡ6]~|(:ґ.P|/ЇNSȽm>sz 69FFt] @¾jO!T u QA ~_b5Í Wl٦naT7FmqXnF@`uy}dGdqCr0O;ɴD%pr/'g{{G{@wtgsݰ{χ`/ @Nl"+R-~TV;n&eFpmSxT@?@dXq v~qSR@d0mg慈a xnVuN+.)b"qk/,Qlq04a]N0BV2di,r(tws::7|DwjFs?Gt'|4'1X63A*gφm[mkpyV'v>pnzflqoFDl(nuNWlx`}lX-"D5&xe1AVAc63q43CI5!p0vrtHj8{ s6(Es 0Gv!RxܲaBy~<`u<@Fg'㶅fv}QoRklԶ8va "-b,@G6!f/"\X`'852sD#SW+s'r.i 6s:'t $l?o5<+B,u|C1G0Foktkƛu"T-pX؁x3>*-HRm84;8BUIzF @1w1ǘy|7ihi)f؏A~V0r// 40VƄGn `h yrp `V@{F'jP Tb-r+B=Y/b-By,px7nφ/ s@qX~kg~X' rX*W7RmAЇS`!(1S`R 9Op*`@wqnd8;=f;Fx8?`X!cG8ٌ-[~ @ wR~r -epk YFm3@+q-) "m=@%1@05;^ֻj p3 rNmVa#.֭do1~Zq#=Aa@y"*v(én֯ t 鳰 LY9n* "§rIF0:0J.Q+HS!<cي×F vo9vxN@x2   Y v vRvyݓH]橇~41Ym23Yv?6 l1ŏ P/01e p Rrp),A,7|cA2&L# "N 80Xhr j F0|k 3X~#XP(R @ 2C"v'7XR-Xfa64p7ݩBv-!PC4Sd?qlV  ೜F֡`ށ:,Ӊ(6qYccc;?0>a  4 ;T4: rr>Kl*З.Xe֡܅mˌoKRJgx4pdr3!1q~Ym{m#m+ú")foV  @ d tm@ήNS[e71" %0P>[y9v@r &'j (jk|9< HhcX!¾vku*N3V;@–!٩#0vo[cXor 0 @9|s s L F[.q-)b!םN0q;P='cAVʬ6rW:sP 6Dྨ)evym.I"exbve-p&m19Λ~RvdܙX >R@m[3 `/Ѣ V;P64~x([/\ȁD`Y(3 C;$3! iSGn)RV).u9X1R,feR`#mms{&dЯrP>kce0 33L@J\t.S @kYݎ6-ho)S+ROde:]?>g 6ʯVcvR`m4m S@gs1N0O Zb񰸬  `@◮&v*fNx4$ /"@3pM:a^30ŷ9&@OlC*: *2]na+,=1kYdBP&XOylӦI vن2m]fe WJ@k9:Pk `Y1e"N|HB+>^ BdƌqL cdǎTL1a…/<\ ʑ"]bz5kҤY';z9uY޽}:m%FʔCn"Luǎ%(fc,:~H/H 0q̝%NwCG!8T(!޺{p1lޫ͉8vj/^Nz٬'gxLtbƔ>lö['n n|Q+؈?a.4˗";(Eo_p0^7Q5ӜOsq 3|(ɎM""" ,A)"n<~‰Cb)X ,x0,0 D (ǝ੉Gq艇F;﷍8 JFҭOC&$zݼ/\ C q *In* x_Ρ,jx6ug-Ǎ@x:zkZ8/Ζ ("n!\z.G} RS(e,?H7 (`d9-CP@&P ⤒?jb'kh!6.h<r"i'BӤVal""Cq:'xF/+e/u;& @XDAU0=XiVvlK(C]>rt@8M۲޶pi8K v#$My'B(^`$zEx8"XAVi)Qc%"䕧T D7Q taG `cjS/Uqj(!d8!' cK' !SB샟t(B:!G)A*-DW$r4 Xd~=ҲBS<Sl`ka3J7'  s!66׳HPFOBf@Da'K\ D4A,;FA9Fdb!T+FcJq#Mg8`61K\K ,yaC.+, "IET8A l $oTi锵z-Ge<&hv EmְBH8$5^'`L?z78xh#jOeD!tyK!X$ONuk+ԧ-s"GPmE#1@óB-X[젚k8}Lҧ(IU;]0 S몐3e; ~vA Jan+4zG&>US6@Qdqp0|lP:Gj!0v]v˜L(h]I (ZGا!hi "#0ARr)LZ蕍e-AC z1zrJ fء*)81MU⻽3xZ9`>@ Fp y +Z0Ȋ Lhۈ?Д.ْkW63+ r @0@+4z^d v^Pg@˔L!WjFF8 t(c?}r@C01Lp[p8Y ؝2Fb*U+ٰFpX,` )@;2gc;h( pr P2c2 7I{ 8;2!J L Q!P/ؘBۇkFgu)87;ڸ% 2YzU{08¸>n2d3t3!J@bxx = `4A%ЦyFg+Y" 6P+|'*!0%zЇh4r{Bs5<๿h(r^x`1+SF^l1)b pdY$J00؊b:聀( ཽ雗a@*@,Z j0k@'p>IIgfIsCs-,WI(WQ*iPPH+`^Js0r@:xqгh !%Э!hdAI:J@.Uk)y[%,r@6J.aɁxѰpžB{IrCt A(rMT;;Naѕ@β"v?Qkhs%-!Dlpl`b@yE帶3P4sM)%6WI/>[y~ʏ;ƕxP:mPmƎsPRSK!%P[y2aX9n NuJ FTcpcxB ֱN" 3×H 7KXa)VU1 H ?(T5d+D(SI܇e|VX[`8Q#(3QKʥ4r9 -M@Qb v8zlxm3gJa"(8**3S`y9y/@MIt2HPe0lն{(Tq%D"4:W)-')ҵz@[H.I4=l M$ k=8#%yW !帨 )plzG}KҳliQ?܋-! HkN46J-yM"F.M4 `0)өәݨP?\Ѝ$ʃ f"} -dp)[ ɰ0H^8GH FgXnj jQ(W0ȟ\U_SZ%)"I`Uܔ\F1 % 2`ɜB}ecfXIۄFnӌZ,Y"6ɭBW`d 9F ; 2c@p0a '2гKXabQ;)'\_f(j_LaɟSs})9WA)ˁ^P(|f6Yzh`JsHj]<_$Rz-rԷ^Ǝܧɑq4i#;hGuUÄ PușaڡÅ x(a@vp%\ G3tƜ#fY3N9r3 ^;bX`))R`Q,E'x`!B D`Р @dʌ:t8d/fMР]dc3ѳE|)C~̨ƓhF,92Fܙd5dj,RW fk9+t[ 40CvB6xXC Ճ%<4`X_&+Hb,Ѓ5}u- =ra×9<3$XGa>`V(?x@tVe)heJ: b14i5%`G/rmĜFt:RFRF(i=nM Ȉ2CS@arF %0S X H)dP5h:'Ϙc-,8PRA>=pN80Nn6hMU" dpŕ@6 DW`12q[HkbșqAzt!G9GLJ>P o:Q*n@ 3`JXf xƲ4 !x4Fғxl"= ^dbNB~1i<bD )@"ǾEVA DՀpBM 2&GDb&S1i> T:PI:(:Rr%WT!; 3\/U4I8LF/1>x8#Fq!ll_@+(A@l%WTJ T Jq tx6I.& C"#';N#u3zQ +@r@XJʐ4D-_e Zo|c'X._ Md_iAWH|1 `|7$JPٙ.xf ہTe5 ]hDO7FADB) Ђ{mD)]J`ínRS@XJ u 2L%I\4I4P'! 9}a@LTT&+ &_!'݂:v0fEbsЯ` `ד=«G=6Fjխxo>̃1D J-EŽbF  ~T̒]N ĎI9KG^\܁eacaTEQՏ#_a"Dx3Oh@dFp(RI t\TB^ȹ1HKJ:<8b[: epHA뼐YhQAd}$d,l'bD|K !m0@gԀ9|{Gl2dO# TAx#dNу}Wf= ]8:9 A ;dboK1]`Zġdm]ac1"JV)AmEFiO\d@5Kу7C/A18BpLAH #֦nRF%_XHyzd< 1WLT$PRia܁_vuwJE&IvJ@pB(I`XS45n@6ϙ*Y+ .a9զUIu[5jTfHGċ@~O|1ЁLd覄gU %DuƘVX~綴N"w(D,ęR|jf Ol;7"3AX2`^oY (B5b9CjC7C7hCסB*,TC5 y@ vN@ЃV,˼˴RTE΀m!5fcAkbjLJx_"DAxzhO[!hA8@8n@N , lilX(Am.2df0l& @ ,.붮 , ,n <㦀2@ $A&A$$$b.`mj<$ATn A8"(BhAp%8#dB%dB)dB&l&+(T%B.+o. C,B.+B0Яo,00 181C.&1 :CqDUQ@hD l"_ C5L20_21c-B&/ 1196 16C5h"k9,?16l9ƒz6,vR:x1^dq7-]:CUb&ba< C8(..C:G؂1xGX5x16tN#(W C~(W8"C5CC7*˲:Z, :G&M9 -; $ex=اN/<0p䅗&2/sϴ,:,sm`]C8X:G!G7tT3xQ#bC70T*㲘Rr;8q*R}M9ǖ1t1Py)X;kRϐy$8@ (c C9GM{p +j@/' &% r s [Dg<AnQyzGɥ>3vä[:/l tD$|˜ Sgc*0zI[3Q1pƜRd(ak略<3a(ªI^s4B(0B(A6kb뮻0O*LbzkQ'pTb vJ|AFЂxJ*FC18gw%FzdL\Rm(јy1 jйe+g22DqCDuf40mRtA2j x4c4BFrܤ0J: P2z(t ,brID"%JA *ub@6 5)Ӱ-P:@Bu1GHS* 3rJI͌1Dq؇ʝ2wAy%' FdtΑyKHQG{3AG K Špq|0cjXʇn&sJp1uer>uɯT: ,,0{&,n1G.I :8kۛ$ ̥=MG}"F' l2Lw:GL0R5f t:ZOuu!$+3N5dD (XpLx0$ ejeFU $w ].! yux24(2hX6C 5#E( Wj”3j?'2ұ8h)60uyTC d13|O} cptnJ)Ad ,f2281Kr@ͬ"D` J؍[`#DTPj`1s ŇD>3&Cd G90a c0C Hi|Ўj

#nC>h™8hր+WbQeUG7vJ'N* `6rŀ @B!Ĥ^_b\P}Ѓ !V @̝ѠV)4aW\Sda̚HE#3AֺRb[蒇zRiTy`H[!U%Z4v+453XK*rhLHWB>t * 2ytp1I @`ylF*' AW*qn4W*Cfoa7aEg4R#:` @%}թ0f D*5]u+Zbku}mak-6:[p. <_* v%W5 Td3#*YcͶx2J1Da/Kb'p+;,% QLf+O R(ac;a '=O "D fJQXhVyĖX\XB@p(NG!0C9¡% FdSlC1Cyy,av8H/-'K] EJ6AP@i;GηZcXyڎ% y9D$g"cBpc$ 4u)O%u9 ran>PJ:9F\dA =--*V%<(ȼP財r"b6Y8$5RGi(j1aAĨ jcrI|ui݀RRSXv%d2&@Xaj` #?: uCraxIBLuDGR~(^.o8y<BgxBxdC88$%M 0ahM¨@ TNi(, eBP W!6$aKz(($Jz!fW&VҌ `ދp !ZLd aJl0 ` g .@ :ī Uf/ l`$ ʠf`⤡>| QR= ~3ij/<".-5T@ ,Q _R` ,( P@ xC+1j~ ̠5d!"BStp2 | N1* ŋ/ rY'DV% '@0  B.G|r.bR(6 @;*)HzeŜ Ǒx+\D/,e`L Nh0 `%,+(W@jN`ؤPx%C J*4p#~/N0,b&O @'!d'S1;@2 &&2EJ#4%srĢuSD&3 &WJ@WF6B @+}rE( # L.R@h :Q$D,,3uNDf* !'%H l,' g< %`* ( AZǼ:RӎѡJ C0eJ%R A,;*v;#SIRf`@1Ґ@+ڄ3s8)0-Uԡp1ROd6戮+he"%|yȄn!eBEL\xF`7nD RblN^ %& IKRPfb13-,U.`g С情 X$4Z'rGgIk Hg \$ Pt4 &@N~ #HաZ5 ¢ 3ij@ JQ)z>@ A BbS #1J@$t"v}`\a>a" aTcl` =,X4cE(X((6!'=衪M0@'Ђjt TB= ' *r~SS RȠ f$LPi/G>A4!uR h>С;cmPl`qApalAh*W혬9* zH/0B :o` ^BR1N%0 КoM #eN*ʡzA!8A|V˟o{Ơ#jj 7RF ,I$a7:f``R# (y~ @!Kz B4zZ\&0k#>@pANn#j@ř?vc0I 0ZR 2ǺFCG(!`R. 4G |bN,r2lw"UxvnJEaa6 c(_6@Lv >#YA2Y%*ԦP` jڍj"(;zPp, a~ v@#Mtֱҫ`j Z;7O<yf V[y' `& ٌ LKc^ E"F#05爆R0lJ;zAV`abÆ:$QG\@G/WA"p† :bDc%.\=sfB qaB-9Kѡ&@F] zaGÖO(9"곃nHzpVnB0M- f*!M }ĝ`>_(H7aEx,K?+b8B`!=L bag Cz96 !J z` +@@A %(+g+@ *̙5zȔ܁ ag10Nгc$S(1 AMMY ;(lء:`YГ(fW88T3Y:v}PĊ͢ !N8v|W;X!) T?~@/&V> />1Ƞ?ƚ:I( ۵FO8hS1VAQR]@ @;p3ogb8:Xg̚\5̳ vB96 y D5?uJ;H iA8uִ \RGk:6 ?cC2 1d)2ф(v05ӐP;"]Y<#sK VSL5KQNVts$: S!C_ANɝ1dI&bECDLQ =cŧ6ʜ# NIV ZbR g]P(؈cI%+7WtA.3JL:x@+xSd( #KdWW^@@RFhB| haF/6>8D)2a$|G*EK18`=JJQ 3 R̐1dZ8÷INRP/;؁ CjLa!pA! > J`2X NST 5ů$>|0m>/ c`c1Q|\A|^,a^ `vnfNp$W,3R@0BT*3XÎQid"S'(aNJG'Xa a9BP,Cp3ho^R*29sqneӓbM0(&6@/2 ƹTFQ$MEgRTU \0!2FL P "H0C`S)EO80\N8D;v~>['ȯ"JB9<31dxV ' e6NNOVF NYᛐZQx pb.!@HyU"`[':K' Op>@P23=7Xp‘½lCҠ?eUcZTLFhQmY?[哥Ě\i%e 2$ DAd(8a"/y1 JF`x.:9bңP 78aJUp:2񚊾֟QJ`kz(/}POp=<%5*|׭ort\\s h9T=@T*W'! `ph$Ȝ BpB>x0F44ӗH 2RߤPF;)fe3H4@|A"R ZELԀ@ N1~Y•2xi0`- Ȍ >8kiyh!ť2K$7ZxŌ@R>GhW jK)-' Ha B _Y p@ FZQ;հFw3n@ Q`3@xG)6k̾"ũj׏Ђ" IxeXKa<rݳ0RXa})Ȁ d31xaV1\'8+b$ 3 1@`qYa­ZD-e%0JAx H/(1ul=oi RJPQ<||+1 ݢOFdGڼ+ꀍv@a2(l x #:miB ՙv}"s/:AZ7R)`D7a5p f *x9dj I n6Bwel7Z %>5<4/pNp`Q1'rd@C r}@f/ V`ED`S a rf Z@/Ă?M/s?ao7OZBfNf` p H Z f@V 'R+P`(Ƞ@tCUŃL%0S_.` P@vB=%`2>P 99QX 3c !mN *!Y4H03RVkRx` a`Lg U5rgNI%.5 pG\ui.pa " ' f!xS  d"!ip)xWeE#P+PΠ <1X2`p da!@4>% `:UQN0v@HA ` `RV`2p)2 |^'R,avEo0O{~"twUiGKUAB"N' '[^:"0HQ Y6OT2%#5Sjc/.7A"#$ > 1.CPp . go `aYT Vj$P4ADiT~ o(.HajہhT " AW󁊊G="G!!扮XD1^@a t Ҋ F9 er.`Ru v.FVGv Soi{a[B@Vk9VKfIZkġ@_A@ Ĥc `>P!QcaPf`"l]zl91ؠ0CI+) ?D }(lN촑R uBQ̡gCed(#ai0\7z66{Qg%.'J 'uJ a.fšAD @M`[& @C 20:bq 4>>`P رu/>0!C20,A NaUBɅ @oO9@IeE]pZq (A qUaj Q/VJZ%d/$n!FDqgR4. ^')/@ `Z0V>0?2p I$ð H9¡v p!ڪ> .m5!j%%#|~?aa{[ndٯV2SPW`n 9@80K j jQHY1vl ddlV0 J&SNuPF %`Phd`HW 8UJ*ޤ|T" Z-#p`gdbjI!!+W!( VcpWX[;M92pT%(>P D dp_` K EQπa! ` 2"$ @%5/ >H'DQ>q\ +oYB" -qbU!Je589 2"fಲ#!Z`,Au׵CG/LAuLx OH9p ա$M!E÷% +Ec_>+*WB)EJ^ir=M%o 08~ ke3VLJ(P@*]4 GT+;dRir-N L>5NK'ư5 #b.3` -EN@&S i `pGrg3H+.`E "=B`YbkaYV?!'VOF ` )))/ PX@Zc(L| ar Ss> @p W(huH+(I`Z!)GZ (}` Qa6%pEfs[D5NP6n4 ~dj;/=aKuư~;/"K-exH>z- `R"DQ GD >K)V9. GSP} 2ES FN a s}4zP?` Ƞ6V5!TW4P =`;PaLQ6߅a/.0I_u9fӖD]_l6ozgi3fa%>I6ߴ!P5t\X⃧e40O`t%`E%cEAb‹L;0X0^DD@e@('3N%x+m2R|6qqY|vT%QFQn.Cms4iw,q7\XZ즥B2B4XNu.#'n$ r)C0VVѹ /0Xm.C"Y,1LA__C`TGi]6l7iVi6fVGz.Vx[oqSKTjXec5fcGQQQcEsM!?n{PPdWsEjK(Rcġ$pqJ6;)};$`q~zitK)`̑/TiH 0E Df0fp_su`5 8f{@ BL({JP ` ` = `U. S 0 `AX vp ʰ|o_ P IiP v` ` 8 Kٔ0 wouLYA O @ ŀ ` p?π -- 9A p)# `0PG:'O=8 21/#. S'0={W\t;WrmT:ue/cB吭d󦭛Æ$Ӧȋ a N:3w\aδCNUnE׎vص;t\W b #HaQ&Ʊc'0:vȐrTczk \2And #kC9ŐP6=kM5Fԭ\Qe[pQNj6gnV5W.\g܌im|nΞ=Ng}2fZ7!fWH JxA.&+2aQ8d(pG6%^zĖ[J$^)ER C 39$Gq$ (03RlC찣Ê Ҋ0# ./m[2A+l'82&fAd !ӉT?KsJ!IK4:4<(FPC5<!UX=h & Z5VrԆBL%jufС #` BW^[^Lr1F^( WA0P_MUPw^L)} \TuxyRX;PUKUJ.ZR'U=87+PlUaY?`x]0YC0ubDua V/ ._Wp :tqfZ'Y0, ˆn(,3zF Pgm ڰl/-bQ}a x௴ObQEN!aJEa?xgLNpvv!uFafwG}gva ݉H'ti3uy'. Ss߱ħPQs#swGhۉJb\ hи/@Xa/_^);xQr*7̽/&dt~@"P3a.`G8aɠ h 0ת|iGgt"YU>M^Ib#FF`/)C"]D9I "4b~`6DE~!M+~~Ph7 f2N X @S|D-S&hKq+TH}v46S.S !Nv[ v*w>x^' xڴ6IJq&"<  ^C-jeD%`p| bt"u\9( ^F@UЂ*RDx@; d`vd<8=Y_k"8IOx{Z;9Jd9sb$lc]Ko2F0sƙ,b4>M6* P(s:5QX! Q#P; d($;햩Ů.x#J}eK08ƔNڨpW"Hxd  К9Q/ V0rw|KD( E'(:|xc5ٴI.oӮ_@ڭ`# q%BeHR5/*_i9 H&7GLapd Iǀq@9`da e#l)$FFkd0(U %e0XvCr9%OovVR'GyNߌV{9Aw(f{Y0PP񀍫V !:Dt jEm1 q>'{<&l&kU{X?1d2N{3f ;>c}c+aq79Hc^Gp܁)f!Q{K.KNI+29GaJxIjs) OiP+q O0Nr芻@ #E88@gCg L;C=2?%LqXF؁H:#y!Tp+ òn3=Ձ 0H­5Lb?]+F38+fGVG9%\;|؁= ȋ AB F73 LrA)40U):w|12G5K4rc4a.g9 ! `9$9;NbWDct`|R`T< H%EX8JYʩ?1ʳc8U< G+)ƃ3IMJV/@}D" -G̋Qd27 !QsPPFqc@ pWs I D3fU,ǣ9"dCT{$褝9s>d:>=H/DQ[4yO#zI ǕUeծ'%"GR/#sZ10??сp T)@\EPG+$׽XSI; O1y ]SĹpZ!l@|{*((Wٽ \Fȅ\p#50,@/(ZI!N۪[ʵ[3(  5tӺJꤩ̛ţdE<bRCCQDp\xWRap `Z+*_?FզMA^E&J;J"1y9@lM1g5LAupiQ>^XWpp@r(X̛tܼ-U\YU5_pasc1Q֝^ 0DPeO: J{JfCXhLIMr_, +Py(W+L !,k\,ݬ'P$:|LD{iZ68DhD>MVI^4⟙'@_W `K.zHLYZU-? ٶ#Uq[U.=GY- YKPQ[ڛAVs%Gvœ3D\a!^Bl"I'LXD[$f|0t8p H-›82\'Q;,#s##R#5~)&\rUZT _jN7T\'}\38뷹?cX @ (ZɕdiUiI,_ FD{$ԕ7<_%MSF٬@ILD$ nɡ"E jycP@i(C !W\ 900g0ۋz66).F@( cpbw]r Ђq@ u (@TH-Fƫ) P<6o܋*PXөW֮ZDkָqOҒ'k3 c`=p #]gcU^І@8Sւ-rN?9JaZMa+F;&Xa^ I!i'HW[hKF); 2+ ?߻';'`؄p`͈2{w5ҝml؉ps (g!* 0v1P JFdU`Z'^L8*$:I]B"yb ZDȮq4{@'v!Xlv-g*g>>˻4a,c8prS_ߋH_<&䍑 \FNx1Ã>J#"&D`a„ `j8b# (:8y2 XN qBn`"̞=D/8!#ǁ=t+1^n!&1;xcL< yv l޾-9c5$, ( &^ȌD^ 1+{ qlG%>|IcFq 7 >-AC ʒkakJyJ9,G3>rnx|NŒRΌ9;ܹt(y D,0X"J?TFG VR4AnۂչCUIyE/]$L@Sp< h, 1蓚a(Q <8CI7cM Ch _id̞7VK zmE;-eGZ6L6CH|U/a, = #$8:pH9SN7h^y#7KC4@%^rE?k L4MwRxn')!^^ Č,1-&pAwXrL̆A^YFanQ)T8Ҏch$ sD;r(pD 0Q mcH:LFY )'(! Sp`+ K\09we8 S:f2%T$+ڎhՑ DoN$InB' 6Dk8Q‘ m#  Qu<#gjdb!nb3%`w?q }KŒ"ɝd.h4mx m692>v9QAV'g2$ Jb0%?V&"'! C z x8:.tT$ YD 5uͭ@۸KMT5$VȰqŪái:!À F>h˹D,aA> tJxE.LhdrF)%Nh!+H (p$8dAbv5FlIr ),pDH=MKGnW4#"I$#L' -@! j`a*_;!r܂̣@z" d ˀj 035#SC~(+]2r`N&p燀(QnF#&!_Ӓ(I| TQ`/)|S-n_1ntàT'!F8|j QRapcc\`AhO-юAd"glG]2}C("ZV 2F<#@ 811& DN`G҃M8HaB܌LЃLY5%E *#&d4 A$`\P߭Hb)PMDjeZgU!XTHt@Ya5b.d&B%@A&XA h! 66hC7hzVcbGiI ]D4@B-O LD @A. 1B7=teSUeP9 Q ,P@,JĀIe_iaZN؈t2T]p,!B9Ta13MՁ"1 i6TVN7|98@T)T ͐UA8poQ1S(iXYҞLX Iի]Wt BEGsbY \𝖅Xiڏ9 C/XA-HΑ5`CTC0@A- ~xn<7X1tC |H"F@-ě8 lmpb:$FgI_-`^ǽҎ8=Ц݌X)Lp,3GnTI8R~R XA6l>À܎`ihM$™dw<=DP8dH<$Pd4+kN„(ۀqgOkH@NHYdiXll4XA}cе:Le؝ Z@ؔLe ,[Ɯ4neWJEBJT4/h-\h؋x㲩0$ I ۑ8wr]l:^sДQ9AӐGt] w;kf,r;]d4+'$_Dx@MęĒ߱J,t࡜P5hu1LSE6/3@J \!Re`6j̉AӘ@ lipu6@ *XT cӉdc#D+*w :8&#hA!1As#XG\g XB'',I$%t̓hsgMϋJHc@l:D@ &T?ah8H&g B!OUxj?w״׮iˊV (PBIPⰹtΛa+MIf}0't%z Х-E ʪт[z)a Lg6QuᢥɜH9, :%|z tJ0*AJ(,^SNŜ6*o*@~:O 4}a,AFyx㌞yǖr @er &Ec7%Ey)gRzqŌي\NꃔJ&RIɎ('?'I82<Rͪp+.^ͳP'cI' hPB MTDXJ7zCC8)Gs: OuQ4LF[Dp^nA$ :W,&.n&,sc() /Ϫ[NRv!pZ+ & ي N?>%ˮ{0|Xp'H3MNz1FC\鼳ɰb :Rm|j-Mnh ضMwʩ-fG BBpzz5_kA뭲'.#Sb P.҃r}]HK[\wkй3D @@uN62j$!`D l@9j4E#Yrɲ,RPZ?000XY;G&k\ l*AT̀NQX@+RP"7&=Hf`6pɟe6 'p@#StӼ2dPH qȟp6$fY.+xW# $%' s=;yKx=(rE>K\'( @0.ʏRg ʃ)+" (t^4I~(:蘎Jyֶd{JB&PLe8畀}TWeo,>HP< >'=r%cz q=Q +3Tp)TA$l!\ h,vJ(@9~I%H~6r$"CXqhiG"MvGBP+hT[2`ULP g`# 83a] OT`G<.zc x'a=` \@*DBGf[RY4R2 @>d(RG̑%/ \򇦷 0% mTc!&?(l3L7^3H@ eׁJ(2 qC^BD:>OC[LX W4:\ԁJv|h<6CgUA  qe Ksl&Ԡ 7ֆ1AM@LO:>%qf=LNh)I8`v+ XGU*#ڑSg"x:ԡ ňD;*`S2 8ȿ^E 4 `dɅ k%ulDueqwh}x 3$#>Οa`LO 8q %ڨ+hKX l& m5*@S'ā˝8:~r<ԏd6DU(0ԎkHpNSIL tt?ȱmm#LB%E6pgh#(G.2C/%6@vp01 g/@. 3Vw >x#r# (>0L=@&Q#؈%TFPfc"YdK-\ 4ΊDļP B\%  6J~x@<6a٪VJ @x2vyj@J}< J. 0jA! d1%9 C)xb#ZBF K.I,& )Jۀ:*0h^r8c3pL: nn J ׮!3̡́SJ,+`> O\b<a$A!¡X22¡လ+#Y|j.j4B.p\Y̅LbK. 8(hH(`/,b3!f.!O .K^.\$dġxn3ED8<^oüK@V (Ar, #bgD9$X\ ŒHxb!y/Lg "ljCΡ0p!\@JJ r! O8 x$4*F@D)n k%>2$n2D(֌r xEa헣J+ h^A t `=i4X!)}r8OeMx*aR  {`BB~Jpnnv," 1~!:z_.B_F'DH hmڧzi2D" l p*J H A'zB )g6E?݄j ħЈyf`Ai]7ich"v0ډUxElkCBxl"wϲ*Hg0J  xFJ ` |`#Hdh$0}Pi\BlH+qwǤ@ T@ Y!O]a*\+,+B*q 1II&n_m:_O&v%Ģ}M(q ~fq6 ǹ+aF@ j^/^叴أg-I QR !Xә79E+?6*hP/H'.y[f@)I/l8k-bjnt `;b\\K H$.$O. 9! V!Y_#: tGL%f$2 }HQQDK,x0BN$KLO6 Q% D`PJ*X޳M>F(L%-IjAɖvߩ+g,!' 't0C <V%n5OyP@D %jP~v1w^R5!'9}|*鉁QCؓTNX2ASp%fb3픣:| :hQ>X%+`#`zCX`3ؠ[hrГN+ xwSJO@Y f؆ꙠBVTb 7XI. b-fhq+ؔ6Vc!I@M1Q]z.dRHPJ801ܒ8BI(aE #vԁc|5"lD>8 ;:8AƑ8"x1ЃN8LgL :xX,, %z,a HE`%hA0tc5Έc5҃ 38D x PUYG5i5 J)S$; 8xQVCf6 D 98aMd<ȑ*x5PA[5Di p!BI ƥ7acxC,ݜh"D'Ѕd\#GZ ~ۖ|D3PB`͗"Ҡ+ġNŮ Fv1}aPde"V $_U([Uv΀@& %;@&U~?PVPXsXp3cZP ` ^)ZR _noe igRQ0 u0*._%";@!|6Nf+%l P ЅPP7&q cq2K?`2Mq b ɖY~1v;*x X$P"Rg)PVL$fpSn>80L7 P0 pXЅ0 &@3prsRD ">`odUl cTc)ҁ>ENEqܳ%"F%p[4X.03@v`0 > ^puT3p0?nq{P p d0*֐/ aC% cY,%WuXh+ Pw !s `T5P d ͑ @^0 S4S`| p %P!d e/R=p?G2m]UVRT8 ~aA̵OT+Qn eN30VV0  VP.6qqv+8 L)&OP MH}#m{Q:t`ZH\UX(c!2PxPP tnAR`` WUu` P  Zu""X5bd*!!XƢkUp~#a 8&&,AJ#s1"k1pufP 1k6πxT_15A)Q=Hamr[#u(F@5l{="+!hƐ 3Pp q|4* yx`g8n\0<56v "CZ"eR0:Gw5%)a[$ EPܣvqP3F| |.8AH> >FQQ<^3 `O!O0 Q NTQ"r'(+$\cۑ p "mH A Vp81e{>)/ 7S 5Z$`]> [RwP~ƀ hP WW` К!01@Q@^W*P d!?q[1Q7Rx UT `@`9>.Q6t "f# ̠ɦT[.SS[vÁ։b5 gU41 ð]6}H}ZP ^f8Kj y` PP[5x  tXHLJ`XP s2cWK_!/0 5"@o[|P"7~3Je,vua P C FX~dZw P0.@GcvX0"H.;@&z c~1=?oe=b lsQ &AGqpᳳq`P(5'I)0F>|<HUkNPCz~T"AQg;0bm {&PddP8x!Ûl<[x3 4lR.Xpuh17?=ISQZV`ME怩d7%[cCj-A%Pk@c PfWy& GE9 lcU@| k 3 (xR%ܩŢk]k)>rS@7[73 cU38: peF a2  iN$QRt" dWATP%@P3.vD'@RY> f a fHQZ 22909n$[C(L-vPh PXm)JsV}l=]RP.UӸ!RJY8$@3Ky#b:&@gt^+Vp 3 @B u!%HX >4R0m{Hz*?A!NQdvDJ3`hàGLPP{+k\uKmڱGN`6(PPia)T "4XލӡK1`Y0x!~3#cvxY~3@6*T"@v#%~["Ci(>p;\ewvع0&mŰ -8 m^0 #qrS(3[P(2!P ` kB|{Х`2 t~M@2 !+]5QM>ыCN[xι&ad dcO1  QJ~SӷZ!}> Qt}T wcd"XYY5w6T ӛ Z 752,qX)@k\)+c:KM3 c*l]NcY&`ɱk9lBCs\#zk:V && Oм@  `<(7}kQ22/#/P Q2ᇦI R>P* 7X'i?We&QipJ@V la .`)!(X=0P h֦HP" HujIo>` Pf pfc6-N d a>@}^T<H R~AwwcM|h%+*T8) 8NzxBCP@hKH EICD"QDD +>RQcF-=gƒPZũ…hT+q@Jh'*T*Xah 'I(Q2I* +N,6tѡp>É?|L8aDyj5,[K&C\oC$`zB׍ԱP؄d3PJZkFKKF=@Q"8 -׵dziS%J3e„ &N\we &)Ca¤AxAFdb!p>E'l(EsnaM-`ÀhM70`͎^YF4`aXXHǕQ+ dAvffcYUG)iۉQIt%TG&onz] oTn\-c1'fkvkAqlylQly^pE`Qx2yJ ^)b*G˱ELcxN"@828BЌo383)p2vCxG~C2AdCtblׂH b,Ԛ.ƚ ~(H J"jf`p2A dȨ@03( J i c48$} ǔ@` $C FЃ`@*X"ݰZ`M@k:4#I >B̄ u8+)@g@0:DLB0nF'q! ' N L,QbXØFVzҘy li&[J#L #v@.KXN]10D(ux*A0QsLL*F'B#G0Ik\D# f Ck>/mV,s+Vغ3p;v7ua mEVZqء}Akڀ~>Ȯ&/@J vJ0; d$-{KK-6&O%HXl7|_9~T<$ѦIj?c[8d@ c@a30< (&chA)3vf%8feX+(H@LUGBqN/nΠ&/Q⬙+*1ָnt|K=ntE 6B~-=bP>xaH6or aqP4]'` I5QQ״'jࡀwt#WFg\8(\ViC)&f09z!$NM@ts±0Qr! p<('8Xuc+[ "jb-k`@uggGc8F(apg SRЅ/Qc 3[b0uA9b%a$2US FPB30Y*sQt 2@C<#גp;b  Wppc&t/;א꜉J0\Pr0vb  +C/:p,JnQDdĈp`k' hǰ%=:ޠ: Rh"ĉC @AL4;Ą=lk8+h$+0nk4tMpIW"N'i$-x^[%D&F \E.w,!+Q~!0Xis0^ 0 P= M"Ș NZ7ZzN:"= $8^`F(F図ܰR[gp?XK 8Zd;A"e9;1;\K*5+jbƭޢJ;+0[Pj!蝍(-Tvʘ ԍ3`> h3;%)"ڹW0f6:%[A"_t,$z1MY&G4|!ޯ%$Z>)u7u]+kf?f`2finVrsP"AQ:"]Ri;y%%j$εbv֍6s8(O(Z9%"k>;:^k*{)+p(q't(?}D^Pgqd[a@uua(q(ZZNk-OYLP2':<0Iy`tVQLTIrKNUKArHOGSROWADi9u@ jqrdeI_IvdWx`l`xqxd2slq)rID^ys8{^9Jp}j-q}wlL1-C jЅpd/,N!a+xA'Rh]y^p[`)IW` LJ *8@oD>ıFp82)'x(P{Pn;oM",:lN+,*Z b|-Џ¥(T~A:t1a+3~!%!_L,?Č&4>8(! DHÄ$K0pC "N%TjFQv*=KÃ)H/`pHi>()*ia XFpC0ng)3@"<'N"~%JVY-t7o=hӪM(၄8"*%M,a 9y+u&3X0XieN;t8$8Zt0:tVMAORy^{s%XXQDL4 1 3rdBE%wW~>wGaЁa @49ySCX/찃# Ecd w-8S:f sNn݆=9ָHu'%Lq`a/`B=:`P M XHЦT$]D>a1E:d9k\Aie'Y}V$D=0 7 :蘃 :`J.PࡅB3L&GOvXؓ4:g9R,Db9%5 =M!L><AbM8o3N9hmSf蔣M58bBIiGGЌQ0BFw!DB@G qtV"dQ5=gEM: `i=6 60":<#8T2+Q*hdP2%I+]TbC|3AؑI!%@; D%H&P#1k~Z\ncmC&6^-*hQ`ve~}30:D,QLM^O0ؒ3.SЇ=6S44 WW >|2 TG%[8#3g# 4F8an Ld7;d@ B p LpDBTH"YPQ cXC+P1qܘ 8!`y᠘1A ,h!uЏ`  2HYBgՍ %C)*`$A  T*YnB`3ISa/ ^\ !C%Q qIJ31,^&J u<@D0(A }N&7 D`oEzb`q"/2,$ lhc`ZHhFwaxʛT$/`EHG<uY" J*T6SB>JAW#?_)i-*2@6pB\`QTd gY3+1 cPڊCҢ&-II3.LJ&bXX_A c V`D/!Kp$ Hbx`Z`# 2B"."*|cUAFp` *2*ՉHPNPI6ddDkf kToHt!0 *AQ[h˚1جҵC 2d/^rqaUcQAA@VV*7%)yXHf;2D%Hg ЂS$煅>!yE1KWb,k.NJ k9 &e!pFx1aP@ IHc\m58-0 7ˍ=ڔp) J@@l f[C "Vt"tCEF/<%9?nfeMei׸v*R*0JfK˸-rAqL]I f<"\\ XE͠8s&W21@"# L_A;>$o jP[Bp* dp9̡jp l:*=шB-)JU:P( P!@j`E͌VrH7 E>l,#9S>`g94 a_7E tWfPD KAB='DaX V @%6 t\#X`uuDF Iv85!:I8@ m"JEg=D8,/CN@QDŭTPU0Ȅ/1b9VJ Y,0A  !@ocqw1/ WMR  #&'/2K/2KpbYKR$2if @X4OAXqx!A+)3{r 鐞zH'$&k`h6 FBZKW#:)'.1u1 y-?D0!) 0OT\+*|l( ALH3O+K.NCW`Ti1_eU0H`3 /M+4jKCh(Ka3K&r1 R3(}2(XROWSAL@`t@'Bl;5o`\06VW7V4TQ1&31eEt:p`+./''S#q`V(upK_<@ip$#p" @5؀ $ *B2xB +r35? fV@_c_-beHp`wU79V4|V1OQ`+ aw6\?t6[/qNy#"UCԬwc3RM2H*!x,,3r˂$uA23615=38>99>&6@'9C-6@.8A.>L16@4;E6>H9=E8>I6@F6@I:@F:BL>HN6FQ6HR6MX>FP>HQQ\TL'^C ΎåB*+\1ĥ aEc8AJ2' 0D#0TȄk_9 7'>2[9E C@*ꃙZǩ nv#k\b~$_1wOnf7ńc@ &0Q,bATV’f\ *'9P%TX ? t7Q8!>фkK[tDeg=+7H2"0cID"6)|*#OPh<xwCŪ.ppkTD%^#T3&)SyS3 fISTb57= hLJyrTT lY; j¹q]-* #1@D`|(qY>eRr:.WP* NURNqTB4.ayåhRēqLl)U"vΔe1Aj.z *$Ξ{ X.}' hZɕr,g,0rƁfb`M=̮9E@:y@ZUɔ꺧l-~CXųcJJ:y`X -]A )Jj]8@6Ble7 `6t2 dp#=- HBd"k%+ KX( a.[D! 5x B &|6njAAc& ,NYk<Ԁ %Р9M`Q ,'PmBy)(K&Q TK V2`T' ~pƋt#.αwX8|e.Bpe OlILMlTDF$17 c de ,dMˌ8ĊXM"`D(B A"Lh:)`Q( 5BqP,CCA8CFj0 x`nb3a !8V0~Njs|{ ǾCɻu>S)d'Fg@Ǘ@ շUtdˀ PyEP܀t&g`PwQNi8}"#vQ0Xuw^w @uP` ˰pw,1a~GV sEa&<_B'35 61H` P):艃itGG] x`2i7t ` cP2,tV)b nـlvx WyF]F` p wxsfg+AP u]BS8B@6yq3b eV  9IpI9Ild_p0]-i2Њ٦t "\FG{}!aGր7%x7F%Vwig  9 n"sEQ+-x@ȣz ZÙ4]g98 bP{ _fT9^46:(]zR/F  'e#ڛ yc 6LX b x;ur(τ+zWasjV~(Q~cvYܱ @@]j B;-u =eBfArꀗ3QPP5r@6ki|4F'uʃ^|. xRV)MPcŐ oG5g,m&P 'xY𶹊UQ<3^z+PbxyVjumx@ t ) pd8&9^wڒeKay$H٤%P `0AM{Gpd&htlf06rzg ɑp^\{WriX,}fz(Qrpiƀ$'e-8?!P0Ezh~0G| p*u @Lt!w } (YpvSgUPPVgU d= lЗ9F'zm ŰkF!q k:vA`d'-ݫ_*ccwxxН#kvx&rP p* zp2 QL8] '}V^`U pmPJ& ?7&l9UIM`z5,ɲ+D9x`x(=aF+Pp狈aWc&wY`g y@ = ?}ɿ :0bV&aXwrrM9+PPV)R9HgF BK`E|VmcPd3^7)'(+i-LY-5}N~ҵM{xxu zfx@p|ҰD–Է @lg-wӉbКu`hQu&1W3D# k\k t )upb`,z'(90~:(&(Ò *l')f7|*a|`.rlob렋V рA7}JƲ$\ y0 H`]7$(KQdյ7VmYDk=mH` 2,r+P`sc5Ǚ+Lzbpxqwl`b&Epdxy~`, /l_ {Ԗ ^:D-zq-"ɱЛ継`2Bp52%TTU S:cA'u*N(W+46]xqV 6]0ndw%w(dh5ܛߚiw oiw'f ǯ x o=^"Fz#c)ɂQVA):1[$.FvlD[4|ʗL8ɡqղ`(B`!][{ɲ' 0Fˢ|~(|xxvoӥ9tIpP7@'6 lf%L(QE9p2 =Vga9/{9l k `XQ/Nŀ`LBβ (K>(*S31R~u~3@$([K!F p|pˠ VB7P؎8b(;(,}'RZ+>GcQ@ ͗X <@0rWH9FK)+8Ω9u) 3Ur XȢDB% RϡC,ٴb@ w<ޱ{[1j~{{j':n4)%F (gtR!N@q#S+PIS+gphbL2dhD fЯ_H"mE^xl޺yR$G8%J3E Q4.N2F̙Y-9͡3rx+p÷ 3HrvzQPB-INT1tCGΙ3]L)J"Q:r{':ɺ| Bˁ*!,)릾੩wI >s2`1!rc #@TP" H4`p!\a8q"(+wZC:Z@ǦIQ|l^Ljβ1Œh) (@Ɯ 7pP {ࡇši篽 0x>2F PȄq`1P Xge.#(鵲5<6jA@x@"eAOiԽ*H9c rH +7pA%%(>42}SuAi䲉ӽޑBf(v][,h=!>Y8a0fƊ83$|FB~9(MB*ڇ^D2[?c[~a{ޡОnRWYz<412+.b\JvJL &J !x ,B/TLGx@'.t .թ+lE+{!A9v6B&ab +!e. I{l,@ ":j_Z9B5~^S" KP^iY ] BYcȁ 4LX_jbtFT Ir'"JcKc]0\[:w5l!y >ݡ e]y }f&Q485ٙc|$e15O 0#E2DX (gOբMQ351X0x9Q2Cu-BC;3*YBcghYQQS@5OtaI&dZӂR: 45C(F;18 l6CB ,R)Zi~P[:VS)yHFs$CX`2'P*6' yЩyS{\D1XL6҃}(G=Цc6 1 .?S1LRuTl]sG!3yBX'4 q0 wRs0 83 2PqN!/3s ۆ%(TJkiH.|c ͌hEIתA kWVs3B5.{8,3XisȀin$eW!TĞ!aH :p`K8/|`Aڈ3Zpepg3gp "X 3 jK .S.HlS?Ψu/C:ȁyC;z]6!e-H4S˷q0 j+`$!.Kk(A&({(3(rHwHMٔprj@Z#"ѰB ('Ȁ ( Er [s;겙ɖ`*ə"H h۳ :> ,)#-!ľQ Q}HŁQY-e+$)8c!xenn22#t`uZ:)+P"؀ P Ι!; a00Xƍ)8'A!q##T}[EB 8}8Xz*K +$QG Yub*yp.H`Iː{H*11P'Ҝh XQ=|AHę{TAIBzB/y j,ER,BH{P*XTpk$AFT-3P@(n(O/j@ubH1"Uj .S H 3m{A3.Õz/+X x >kH1`'xBR 8ų˾ g(i+ 魍};#.jT8YJ$Ѓ_6Xjxm(<<ȓ*/!ٞȀ C*&ȡ V3MX +#%-1 ؂"x\~UTه ј*k ^l '4V?,!:pʀ.(xj;ddOYHt('Xҁx @ 0(& 3|){9k.0 42Oڂ6BQ|,gxh*k5p0B u- \(!S@]=x(2geK1(8)Հ#jUSSB,1'iS:zX)+I(@Ћ'x-ЃTxK$QH- B* pWLqqԋɛTl%{Ў5T{P+T $ (ՀJ;:˩XyRM{t:y 14&`-xg sHc gHT|>_xH)X1$$$il1*蓒;8QtYyBkmT KyPG 2X³h.ʊ:!0=2]!=< ү"(}b Ҫs0xз5U M-q ! 1Ȁ?3$#)(x ' @ n tde8s tP馻,;($& }ל :` + TK!)rФ;7X3QQhbЃ#T>}TQ ~ô3"``="e0 `y 8 +A %qxxjXFtgq ypFÈwx6Ah M uh&Z Ű8yP4ڕC(82ɷ478uQE%Xd|^UtUEI/b 629-P %F  H $1Fl x ؖ^ehPz*;z Eý@(5,# $2@l@: hJF0ͬXAŀ%#!;>LC*QM^~ .Sp}3xE(rH;JdxИeH.ѭ"ەI_0Ӣw(u<qXNyQ nx)C Hx+X5k"\^ӄNt ;)Mp(#/ ͇.x_2 "(@% ̘߈(#8ʔӖ1bus6\QT@KYۼ8A+.13o5 k 'h A;a?_da7dSh@TЃ-Vn/Q͜ T( nmQo;$YQv ZKeP0F_=_t؄^S րhP)8FzND |cAeD{ SŵḖ>8dsJ` 5RÍi ."".R*""kh"@HyqH# X0eXpqCFTCpYq(E4N,yh('3 3[ D 8imC8Ê͠P=!yI;LTdQU~(s` _`-,ߴ؂55a7g 0xWx P /(O@Y(P^ { yX ax@LjIŌllA*dZ#((Y`كVQap@d1V1RˍI׭ D5TPyhgEGi .&;srPz2\J aK n ",j#(B` T  ҲfŸx({[5? dR O];5*5uBp'Գ ѯ1༔OItc2>w xɊ |çcʌ=Y(b_4d]8QSFtX_^^^MN LspT<:&*F.!(ީ ծπ'A: ڞ3K1w949!M8#&+4@D dP@X&3|uQtx,3=л~jU~rO3q炉 ,_4;r,a-[0X(a7ώ0ƭQCEqR EbxP@P8Հb(u4)TCO^{ȭ)" \х]t4L)L (( )P` @G} T8"`U2ijaFE"y1Ɛ̀+ FdaT`\0il/Rz`r0REBB JvB1 L0(&.FX %mhiu rsbdh,dr}؃03Q vX`Є ʠ?tn ^܅ 1a K 0*NQBkSMGձ]Qy+z"2hg 1B,!aEAiV P= EQ4@1+wP[:;P..%Ϡ@. Ui|c ia 9S65/5dI=8~rcA2$Cڎl@C!pa|cD )k^G8l9,et Ìc::O| B hdkeDPf'Yg:*cUׂ9s0e ά!el1;G`erdS+B Yum BI i;<`]iD: .\t 5ZTĎ==;\Gl:v3 GulpMAAH8P=`: 'i(G`҆K 384 !zELMtzMpU>@xy|C8<;_wlw;:N8,Lg4\DԑĤě&VZpJll:&; X[a ;tv' 0Lj`ϪŶ,&6Džl*H'ѢR1 $D4!PC*M O-lC*td 'C8/h/7 6AIїuvs ]̮hVo9̬Y%=-6(?C$(*$`$A?öiʷA$ 9 !< -9C:lCLP3Eyk=B-x8t@1o?fֈ (K4#D,e@lUptHMd0x`!$ab&@8$@@*C8{ʀ$L.zIpT=f<  A!8_N ҂ON=l}= @H½MCa< DE*ؠ%p';t?X 9dcGWZ @%Ԁmƙ8>Dž5,Q@-̻@@.a2E## 4<8?*=@8x?t?@ ڑ#gvA33ɀƒ {tD@: i*s 0| 3g:hnpH(:x,0TEf(/>*G?A*cGD\cG+잃 |V5[xE .U=LBe:.fG Ǻ|^ >‡ttF号c H<Ӈ(t.fEHomc84vC8d6DoHo Lg@NaG?[/<9K> $7b@P˒vD@H7)@@ȃ(Cr@gW,  F"ʼn/#AD`b5XL!Ŕ4h0qB4r jŝ &n !\?~"E8 P{8 Y~<2+5/f]c侀-[{ kTQuAt()l }ٓ'^rH@ 4ȃ `pXN X 2NΣ Q'4{Ա';pӎ-ywEsYǓ`Awāb+2w>yڊrq&-9Ү& r= pEg. *Am :*Wa~X>)m e;-+ Qޑ.@bjkWhFX<):&cYOT~AIK'=RZ>,ޱ+!#7@'|؉ea6qrWg_@ҍکb5`ࡘ~Ѫ'@BsXw>#Y{wT`;zq^GL4 @@b!T/W@+i) $< 5 GmAh BAЕVJ!@a dSltCxя6l`3;q3@{hEA8PVv16ׂ 3@d)(e8C*-Π@(SK0)`5g9<γp&!~PnDB"+^hA*1_;Aw@P1Q5CzWB.5K{@ nB[p`X>nL+,QG/O2xІ~A`51m[.p h$a+Y" F\0(!kgTTh(e-X$DL'DWhm ( 0L d//2@! VX4`} !\L#ʰG>&Q$~ ;`=(Dh <@C y!3p`8 (ZA0Qtt2(+'%׏ jTp|@w@NGu LP hp33w5I0Cb+N|{ÖW"8h[]bgA](q"59Bj hMAA@5L3O_`v &t؃8MmXk/ 6 aDG@5c!gvуA¢83Ÿ /%jf5YA0a!{X_Ū?= Z5j`QF"\pDC^m ",먜!~ Za 4D9X@aBN R|)"`$܉j×43^b3! /f@)x+$!4x *N輂&!**(P$!$2C dRbZb$]@4 02bf/`d"<6BBĢ BAX~AA]chqa>!+X@@a$ $b`it2hkk`<+/c:|Cö,ha t 5A,*Ϫ ԫHt f$A`dfaˎO2@TaL*uR!Њ Bp&ip'( 6Dd`G1#(r `jEAi\vD7 z&gFn <@cp +&M<6 ( (6:nH(bz2$Ԣ+nN$xr,!V(2o/fD#  Parp` ᄈp@fpgwPC ah}*R#P1v`p@4 @|)Yh"R*))l)E6`/+)p@@+A*(FZ 7T"6y:" Yr L7A"$C( L2 x 4 Ofa ! j$AeK87 6IA>DK2 & BA,"t ,$VBFx(PZjC𞚇q!CRc%7eRllp<.i 5!0\`Dc:9"&9XwD)3b s'fb-ĪD!С< #>A1Nh2 ' ),B@`fL"!4.o/+ 26фh d4d@hn9Z#d+AX &K(+0a|>k zi+}4; dXXB0>jEQ3Bh~@ MN+TK`0 AM3h8&6X&J@r %&T)vH:R+v#X` BD]KnDV@l"B)$l a @A^|T` 7*&O35a߁H-K> ep*@Ю#, ʄ 3-6v&+a` <"2wd`Hb7 9\Dmlga`c)pMd0>>B#Z*cfZ, e>bLΞ SLZ>bmL4f!$,x$F4;@Kj%rCyءuЁ4"i"O'O!NN62 ֡PAš:4wl-/ Mo0/ ( Ƃ LVR>f (ޡ"bhj/L 24$ J}2=A&"*a "p 1"|> 6#*3Tah{H *`GZ1F,a 'v4s h!0ArHh4JD "&#p lӶXZjZBd >@Lӿj  @r!#Y.b9J32$ʗ~A2D_bFJ#x&Zbҩzel&J* x2jb̩ҐrҞm#($G6N!D!x;.q` ` "2HU56 ai@("ng5 ;Wn O43[~mr-bPO'obvN)' #W&OT`~ʄঔ"" / )^ *5!e'L`gE2"nL(s4m94ӠMh&䖅 #@fI_I46Hƚf"+5Ϲ`f .a " 5(0`z݂G"@!HFOob#zm$"`GYxR4 )oצGzXO/B֒bQľp  2Ơ2 MA"  p,A~(b o@f&ȇڨq;fczp$vPnjEeE943 Hi&V>6^NbW"n/!i'#g qj2F H̙ k^`xOI6@q_t| 'yY>| 7Dr"0r8`²|h tVIFӾ@~N8nKCXҷM nT(#02mk 0%BP jaV)h ,D. ok ցB":!: ֠:b{_H2|eexf3 ΁.d0$aA'b Rzal~#R"qRY >~+7h)67 |.@> .b*$ @ym34{a2n%YzmFl$a}QxRt>g<8C.9! "G8xF $踡;B\m+B f1J ҸAQ>P8(ҨКj/1̢"IjO z[uÆd@`΁ 9GqbEF[/2=W[/#H! DVITHt!:D2X 4 GFA7 M x@^PC}KjrRGO**md! 1 x3] u  & 1a%TA^<<8xiJڟpE ,(c)2"Cp:ڥgQGgBQ$=TѤ0Yd]}mKBxY]l~\:y]S+ ~]m.IuC@=BG(b< A GA'*\a9cOE@Axn (N>` S s]P# MM j!;-gMr<`j:5圏d`ԅ)x@-suORZR\-! O1nPڏa@IWԋtG/tɬɆ;<P0 8q#9n1PP 1<3E 1 xKEYD1E;&aE vKɦ(%M`f`W[;=Eo P$Տ${ /k6@P؀4@!x#P=\;ռ@#gᠠ=)2 / ; 6!؉C Gp.% @'arbgGd|IIXpyD;d b ,{ /\#1:di[d+m 0>Ps.DVMP"g"F۰ЂOa H'P_g DYaA<y(Olȇ=e`G>`.Oc )pԠ^P4 p]S$*"[%y\g@= a#9@lˀ$A%EP#j^@.A "~"<1~LpN:čĆ\2DA"A(D++K$p0hA1|(f):9R/a⢙?A@Pji 2B*3@Z??}Q2 sW@ &x8 uB!. + G?a k`9"Jʰ2P3̢=A@?ڣQcc/ZAE&P tROZEVxPU-&Sl%N2c@dt,a+ۚ `YR^c)&sD^) ʲaԢ^kqB:k!&&=Aq&@ P ' ^9"z-qUgl,PP]0CdRS! VP PJkFd\AIVgPת P%%3Se&lۡ&/<+x wHzH/VBP=[)ꁊR1DdOCѝ:PTiB` t8cFc Ee(aB00gPDaD>Cf!= oo,\A;9FC5ҥ`zVS g媷Kb_3ٶن%q5Yokz-z!Zc}A- `$10\NPi9|vjdavI^8pAF\ H< (kTjK/ɂNX2>,`67qh42f)\zLJ,A1ZF¯Q^!r#1g` ^X4UPmfr-^1x ,XN3yzz$ JU#'x1 6:-qOԶ`cⳳijBF#zfp E=&J< OJJC>5l|[ )^Q$FN,`W EQ'A&==}!k&_3=Nt3a` 8 0AH6_5RbPj zNF $ebBH$vOZ,qg%ܦT}Fht'|M ~L] Öbܚ9 g(u9 9P%ZӳJhKũ\-hF/ buP#6AbB %.%P<&((qgwGmWcv)d-Wt)7aE+5E Q8@]M5HZ#ѷm"`P BQ[OCȚL]+1ٽB&>!lE3kNcsumsfwG>}nFqVݚ MPO %CA[ÜŻ_yx0 m5 jnV$>`>@1]]$m ޚ6 =ۖ.k bNt쫏1A- `  74 I:ʵ,%IdNZ#!qӇ"fwPwv5W^2w!ݦQMӖ*l@}[ lS  19@R8@ `csE` ARZ#BZcT,Bqda#^JG<®Ņ=>}lD}^3[M |-psHm˨9 9EY %omS0!A$*VP$>Qk3Ww&%!ݿ5%/FL`ejWbQMpQ-@/>>.}Vpo4#b~: ^*UobDv7N&Ģv= ?=ʶ6&P5 .M&rF– 1A!Q`rs4  03ʚN@MMpK5JLiV P$.~cUAiϭs5Z-(fQaC `ИB @(D D% 5) )a-|! +bF6Wh3NjPуńڌmԐ&bZ+Kв!XlnHE3rt.gJmb^V !-Q4"# (P4!bޟIK6) %JCf4|xB4 $ˢz!vG`18<&NҫAI Ϻ*! !sI2r+,B-A0AY ꢈK) (R zz*3΋j3H,BCT/&*j <w,' *0[±l,**βVQ30 nGʠn9֢xBɴ0&Š.H (.Gz 6f-b=nR-m%nBz*'U,Vy{}K!t99Ԋ,u 1V@83$d7>rV/\bB=*4#E+=/\ 7X~o޲Ej-zryG!(jp9jOa 1٢GӎT1A"1Q IAEf [\%={mTk!_C"d (Ȕ2,l WFH;awhhiAI&ta%EBJ"I=EBER.ItjJջPdB b7YU F I y [@֓ *8 $Rl+Nfwpja ID>H$#%)[C#K08 z#Jbng7" T*m<]]<a%`B8/pu/ Mkne>I7d<,`&@@>q$5R4mVV&+I -%,L\ijd%+hW,(ȃpblA`PYt-Л] G8d/}&yZpg ZK2:N#ʗdKez{'ʵUԛ+phؤ)qUVաcp!`cf&[Ě͚WEU%| =dq)W.'B!4pQwNPT%Z UgQWWʾȡN`h)² PE zpFI`(q*TX aT h 8G$!i| A0 3wBu #C}IA 31r+[zlqk% ^`:#o!Q< zJB1^0P_4HXy#a.(0JXC3߰ 롓JD 8FN;D ({Y(w{Q|~I(Q5$) 'PDīzԘ 'hPy0shҘ\@7LQӢZY!IAU@:D h(\ Q4J-{wEgH-` ɉ4+ 1C< 9 %; 3Г"@=  bz7z ] *l4} 72< YL uG~_wz)gLӴKz0k8mի@0(`++# 68"P*H*x p[P(Y0aLZ:.L$T[( qgx-5u0 pJJ63B 301(&xʉ0 ƭ); pAƊp 2@̠8Z* ! F̈H<Ͻ2 I * rh~3g@|zPJJxM8-.p#Ȁ\/ 9@:Πʉ0/5'0)ZQAzDH-9E"z<_?#+"h# Sp"'‡uЃ홁܈ "$KɊ8(聡O(6 Bi6PI[RIAjkjQA۪񋄉7?՟@.q0{pBր$3|,* \˵Plj5lt#q-(# ~xg/bIx@x(@sy 8>\Gػܤ8/-%/1JҽQhvu) H{{^ uhwa2dD :}bl< l‘RJS 7%ir[4 (ȇ|rY@H_@wЇw8pBù`X`B*S -B3:"SJ|0S~n iPe8ˉcN-둒 0q?@$D rՄd 1e Hy5hPg1`3PWy3?m5j+xO`YdMJ~ M {f31`hp1A\$Lr9 J!I؁wPJЃ`e5~\T0~HtyJZ1 x4#2Bh-G\b!T0"Za);ݳ((LȒQ(^ڻbh[Qc`uumpL(`5pYQ8mPww@5gX:w0&?0ymJ#\/(1]&kd3 P ˋI5rю#D!Q 9Id%4za>`B(Hg(VrS!vdPGYx@ta7nŲ6&'i!)iva ` -g9g,Q'ZqKf:96Ѓ_pg@j8pF5Ћ$tJ#j*90)PۢC~pǩ( H.qZ58LPtPZ漢b! χԔshHaƹHpM 8OS@."LЃ=b8XT; Ro>(8k Xa.8-@(VWeHJy(/ȖIH(0Ï5mB0{8tHWij(rȇ5/* 6[\Ó:QTv| AooC!y$c΢SYF i5u[P,dMMb@ p Th0p[pMB{gqv{XaJ 煁'aͰ- ?,AY{U+CE@i bRHOA FQFy==`rHfa 5n` ᆨsdh!i&9pA"F BХc U#MB K_UD6>T CqٷVN%h@QPEAMt ֙VQ:؄PNU %,SfE$LME P!M8i 4,GBN8PD  IuCهT^P C^U4Ce%|6foimWeBN$1eT]<0]Y5@PqCs_A5` .9KQHfaO&TN<CQUH!di)AZ[!ۜA{˾WښATE9kהRa~ ISB94XD@CЕऎ FPEj|xlDQùBԀCx8qN=[N?^\ 8akwu[~-FXZ\zUV5bR4C T` X}2a$w"\c?RZ5p u>hsfErzkY I&#QXs9SP[D Mܠ3P(7xoq`yo]U#ь_T/m4^nz'Vs3zAACt daXDNs/ׄN/Ay5ך@Td CMWS:I5iҫs 89^,!moaꘞ'cn%`5X@br019TPѡrg9|+ \B sS`S4։~:y!#lDXI?u)ޚ^h@Cc%)2Q$?'0TXhiXC=AQ\s G,w?shvDA xP]4p%}P#Q:aX6d =(<F ertJ%H x # JE-כ8U~ UL+4= ]Gdk1!C  QїN$E NBr1G]$w" x6b Fa9 Bd Ohh%umYT0tɗIǭF0CLWn3ҏ)AFF')LȼB9Rʆ6:r߁'́k&8'=xq~== du%1 5l؆3FZQ ,jJX5/})見~ XZ (j'"-D__XjY\rH2$EL`<*o X}p{80 Dq#>9|Ql![IApFfbb鉖{\Z>_f,"1b M`Z4Ĥ2*(e Z*\+dbd- 0B0AE@ &`sV+cŜ b}pzcxpbx ԍ=|gB CP3Ik*▖)ėI b0)PgRS`E&h$/H*4 E u2H@y$Sh A#1̀k}% / H(m|`@:VpXB'(c& k=Qg+ PĢ0G;?^@`eĔ [kEvp .x ).MEJ HSHljisBY 91x&HAo~{* e"z0=1b#=R A>83DяbBo5pA@s]" 1['* >fɀN\'@*)_! m QAœ2%bm!Eh !H2/o\dDTUQa|LZk؂$x H%* B2b_83Y>|ag *GkL*fBjc %wK2pH\s qpmY= \YI -Ҵ HN 8AR@%pكp]$!| `E܌{1|,y,X`EI݅j 3|p9h|͐\D` hPEƾ@ğ% maTĉÄˍ<$:dߩu]Qd ^\f{p@ Tą-PE<rKvuGQU4X,HB*AYl,BM=ߌxk0ȃU8/;2BB M|B]åC$ t ȄJ2LRSlG*L`,>Hp)CQ,vTWS yHWHm2EؒF(,TFpΚ Wx{lHm1@MH$9($Tá/8U3[A t'uRI @8 :C>;lB0mlKt1hJ]*&lĹR+{e,H| 1F|Tce-(P.Dm+n;hly'B1C*C<8A-n/6YC&;!A!l'9*pEtv~ 8y'$oj!A4 wTD&.RG p G a FLF4Y3DXը]ڮ3>8CX6H828ȃ(%%!B*=PT,(C]b1;<|Cr@_qYl6J:uN%D xJ8QL%P]\J A #lcL/[D{&c =D;$8C19`'l6lC]:*P&βp^@ iHWT?Lq0ÃJ\X寎"tH@VQH0rɱ,!F\ "=NA|1:U=ۨX];;-9,3`1:/TBA@ t2,U:ȃJE:xu-њGeZ s.?ۃ:Í7}M猨OiNn R{1PH̴pՃ:;l::(/$82=:A|*A02.:,o,_L] \ŪDmYDJ|-j,  $ 9P؟LnE+N|^iV]J/*l9B!H,2X8:Ax[B!4TuA L"iБ  Z4"$ <8@{H+f(^͂ 4hB;bapp4(("-60CgqT| >+!"A K5׬΂ &ې02K/P/23 1h„"CM(ȡɵ.! 'w Iqfx@9$eqJ.bX@ (؝3΀4z(BࡇIhyG_Fsf0 L-a..!b.&l"l+!Q -JMJN%l(P)L `Ì4h!(Ҙ(ˀrpHX $.` (BȺ(҆ &V8B.\ 7Dg)F.`xgwi{ [((g`"P ćaԄ4lL0 U1-IH-O@ jTR*&?AAD& h AA9B@e/ Rs< iD uN, x/R_G1x<"8EQ`"8^qA Qa ,H3# PsO c3 MF@9%E9m2Q6eyA1wPCΑ9'-z՛xCJ ,(4{bxBxrP,,fQ [̢NM& \i72A,u9 -hS(tBDz _;AO8(  lB#2!0L3BEn-e:?{NJ`G0Pi@,˜pCczOhЅ[X<0o8[%E0H#diA,Pr-9A5B@C)ٳ)Sq/Op44j KŝuA|"Vi.00ncR a.'XTriLfވAر s,D΀k!峈 8c  %9:Y/;N{ Zax!`ID2Pt`` x|` hw$ c 8F21uFT/{%;`05lrH0@`E@E* Ot!x]1(-EcC@|@ӾkB-!5q: BvR Ʃ]G(l6  ܄"bp2!ePF#V!TtKZ ,d qq x\iRcI PW_"8[ !@X3n*v#HrB bo0K mo 6Bm.,@'/(T怟TA1I7mzۅ X<((>!`9fPXN5n _c ` $@^ŽiD bb8!!GXJc[5QB@ hTA Pby'xhMREB ZEyA\M<:5h¯C-thYL(az/ G1IbKm /8cIIJS<1#d@D_*Qb G AWx5z"MuL 2hs'i:,F9F12s4c0ojEgV@bL0^JEiۜ )yMDL\M ǘ x'@(@aި N ,&Ё$A(B$R, xTsN\I@0oj*jx^A,E m!H 3 ~ĠZUd#(N- %.- 7g`n{la6!  c" ޡ||@Mfr`va|A!amIx*1,J86`4`!$<n4!w:Lʦ ԯB8r Z@E:#X@d @lq2FdKFb@Xv'"  Dvf$A Ufږ+`z@gK-Z /gԀ!$O"nb~ (a(Pῦ—(2,n J kno`@jaB܊κLPydE T$X,f Pw Wۖ:ޏC좝.8&)WΠ֡oĶQ3N227v {a!@ h% f!a~Ap@ A'AԠ RqXN@A aa DHa+! =p ڠ>IGP#2 Ar ` B! 6<iA`> r&B`Lr@mvؠfaΡ̀n# B l <A ! re9ց `D+BM.)%O!(Av`` 0o sd`bVA A )l =#aVH !HYad6`P'",ʤFGb lT_Nށ6G {@ :Ά@ \` v dZZ;>0N! ` a*jmRN&B ~Uaaɚ=|b4 3HMF>ǀ3^E^haAЊ hQr ԅ2Fn'$` jSf+)<]tUy2  r(GahRa~[ !r @'T:$RaAD0 r&zP ;ր A/fqj@V^ B)> ` g`  6@Fai`g\*±l^zh &#M &R:-B! a !Op~!Ȗa n>B!Hh 7D&A|aaD66!On`VhD$ iMx6~HME`xF>,AꋜfB a,a!\&M1+&Z p*&a xV ..Q Px9hdzn ̀ <DaA&M` C J>a!'8 `p܃Mp@|D@ @;70 @x(<&5>>ʱ$ `l(.@ `|l֤0)%.J:2f KE@w&s6d 0[ Z7I @`XVA JNv"R`>Lh @ {X [ T$>hgh`'Xb `!% y38tM j$ aD R  n" "K4l;oT? ==*A!AOTJ. &~  Q[ha|c(ϙX [n(lDg~F^ HzHy' `Sb  fA; 74g/bM)SV Q'(a+Q!e>Hn@;[` ˮ \V$yf & R9h2 V#9C%6@M Fgh:ZB6py<`Gl4ANxudU(-2wz `-T${ְ' t:)b,/p-p@̀2K:naܪ\$rE"6&t@ ֒XGfPO Ąj{ Cg銠 3[-%JRG'@Dl dzķ R*VV.4< T s7Lm|bjb&04@$c 2Mz@ a6 ;RwqyAR}{A!!t[6{z`|򁙷 RTl:-i N4DWQygrx3< A\@D z`8FDE`IdjjfI.1瓡H-25b,JJ@` ΀ !hX &ȡUܛ R!\a `8j\] 4WVTQюOΠ xEz f=?IvD 4uEAȺNlR![5<![`Y\LbLv 4^kBļd!RfV vMЬ@fӦIM(o<{ك, ,9Ex%M (E}(J>p|QrqFL3|1†[P/jL!g< E 8<][DPb'XrF!t*|'2K(b ,L0b6ғܰLqAH \1.W0<뼣3C;蠓8S(~6oCCy0kC;8&j0o=&Lvg}f:ۣb<:l<вLFtq*O,p#:И_>VM؀ `0*@YPC}^hш&{ Mf>#z>4؏X^' dyG$vhwȃt˜]s#9 B؆4! gp: r,cxv/8 T|BPF1<*38? ^P@DЀ*!4j Xp u6dgXCր/mWz8tIA5Pva 21p'h ϶INnƨAĝR#T=j5Jp+RfRdA d kJD0:4-p%H`^i)VRf9 F S:z0Z͠DBH8a~8BVk"i "VvpHBҥx^QkW*2r98,c] [UZ *#Ui[9Ĕg}pQ3AYmJ2*UӰϳ*0(h' 5a h-)Su*Ui0pX XR,Xa.\!,=K | ] ؊@W0*G X4+JL`zzWjQzqU ٠0,-"jK/Qg4%и< g4*ԣUX@AbzY2\-A p ]Q,Vx#{rZV̕gS""P g薈<=Χ6 Bp Dv-A`ၢ' 5j)Ace RZ8+5J2p/}tb w!L971 VS_S?0W6@oXJdڗ)[3W |聂)`w"w8eA0/8tiAL08( rA b Zlf0xx38Pza `P9˔Kl"@O8]޶A3I3v֪\e)56M%9oe8b;WŹU,H!1X4)`ubB *Ҁ/c28)d@I5,(i1xNX8Ѐ8pwl1y3ā=ie8@ϳ(^# 0f`Rzpΰf͇S!eW"Cd)Aqmp" pYH] pb! 0 5V[8 ao@h 0 Pl'lpD]@+v' p Škbck:" o]Q#  8 Х41Ӳsp_:{/=W   g u PPW3ҋ8 '`Anq]_V@%qdRYu%` `'aBI!Y7xrQhJz%/*8VfS P7N|"”pC Nt9D:NdFD0:MDDYY9]90 : @ P='^츮>21Cq<@C`D"$@3^>Gt<# p´ , ``DP Zt+E5gGbPvA XH@`| v1عx8= `*208]$g_8MQXעT Э  -Y A  G L@P@n1k0 @O=h+}YE i[^PwchiqgY6%\ YtW;-'uBPOB _ mB j%&`/2Bg%b`VMA!Gc-A 5{ {̙C4"H@]p!ħN44fL:ult萠c@9P1uTRӠ g 3*& 5 >11r !c$ڢ(B5 =!I4;v*(8pbjF'B!Iih"2]hxQ.&)_ȑwsngwQfU(j@6!5a4!_|ܼr8CѴ4l o(ؘ%-\aHgtR) & rb~r/ (5 4dSxF[-+/ (pخD B~@Cj` F1gHQPv;AnCOp( rfnx8L"%A!r 2Cb"M めIp1N8qM`O0!6 챎Y q "ߌǐ!htTB@| x`3TAƒ!t!@Qxp îK9 OmЂ(D! l X%TH xA2pO$X'ؑ3z,tapЅ{+='\?`|B pe"`G" 5((,9ʁ !HP7\G[Lo35L 0A3k@> w3$"TrhByU _5 p"t%9A 04F64"#Þt Nlq T)0H(!b dk%4lq銀 ' v8cҰQnP 4@^"BA[t1ɸk<ޭ]+*ā~U džKT=nkw|ٵڙ! % 苮ccm\p5{vus4 Corcmu=8ے3>wJ4L!NV{vQ{2ڲݢNpdTx~m<46&|:p¾ N:|Zt+.:kˏ &b)_s*|p߅`!Vy=UeM߁k5|&H[zͧ`L p%u!^ԙvYp!XE(uYwۋ!Ր{V|X gSFzQc=W ;GIF89aD  """$$$&&&(((***,,,...000222444666888:::<<<>>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```aabbbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222222߀,D @   ;#F@(@/`(@  dF ӆL.=p$!?1BH$@鲤.eN9"=t!E)R$GCh38rܬǬ nٲ,VTBʔ)Q8E ;nF5j&M5m̈!c&4͔A4mڸ: -dڬѽ 7nڨY3ݳfe-XpJ遛e(Od *ңXib"?1j"?$Yr $?` 7ԐCedQFE3: : ?A\4@ OxЀ*"F t$@P@CK!_QTwArzB@CPC4I({Сkp]qMVX3q'{Pd\pxZbQ8dSxatֆjj\fkQdF_XVFaFk|ah` rakA])\YLDOXaءN0DO8DXTY,1_TDS<FTDDqFUD>S> GluEaA0 /K$J ܸQd2PA  p 0 ԕJ&Fdy\7C CFdSAq!opiWwZ3Uj=gi0hOݛS_xօ`|*`x1ni+q!Z&F]`qYg7af 7h6#h%NDl`-D=EZHDFSlS^h[H!1A QDR 19nO fտ!0J ?ѭl@op<@R!H`L$Y Fx [ФAmЂ % :z/"pAy2,a *lJ܂C3q5aOaF-A LB08Ptq XfmS8i. ZV2s˂ϤN1S("ozS$)yxS ,p _ tn #+%$^DŮ'}$= I}At\F9T={SP1lY Y @PP@F@|(AE:1h L%ai f89@L e' n*g'9TPh$&0NiŠ.-Z| Z#kd#݀&V1F9 FB$Mn9X(CHRd(C%F)-tg@I. V.T%P˽7{ɫI$ O{gyVMgȀ/d t@{* p@,@IJt G l2H6[kB9'0A ^C`ؤ&ɷuKCJU4jR [,8<*Tq"+_!u>0`ҜTӆ2v #ζ*dj'p[UsU,ȱ Ut,4[kI#(EBc/ ˌ *XIwL~&f d@d)fhĿ\vȁpUz5~ԠSM7F.u&Ake;j'=<(qr8HA!f$}T.Z0G0[ X@d 94ņS# !;o23 `'@B,Nx)=2]KB8L=55}R\',dr,'d q@+'ш]j_︈j:@;E3=8*EIRBgF#Op7G/F/Q*9s2hS0@ }!pJ?@fB& /UbEE:9~_h+&| R/0Gp'Ra ;#5]`r5Zqј@^+0]Cq*yN[\ D\Q[%C ,od5k]ww8LYqct+w &BkPN/#`2[R\tk^1Kg]6̺D7lccFG*VM'q{s:P:TdńfEpa_\]p%;7q% B$? !:g#@_i4Kc|%ļjeFcnm̘^bq=EzbϣJbBN#D$ͅŌ'ZwU\Tဦ{Pw096i)EƼt9p)^Fp̖!牼W6Ux*r=9ujQ)`CPN@е? /[ R=^9oqi"Xqhraa[ TY0 %dw|{@a } ""'pAPq2q׷y1|I9Tz6([fEwaY+t7ǝ(gy+]a阑rAפiO+,bFjWx),3F_^W8Cm*f>/b=`B)F!Pq_f:_8F~G6#$7NM# $ p  P3iXQԙV C <ټ1}n e4\JS]_B:$Tq5r&kS('P$P;ȫ+YtGW򨬡ܒ7 a7]nߝٍB2/_-&y^F>xm+Z{`<2A07?Gv"d(RCO MOO Ob\ڥιCYi$X'=rr`sjrRZ]+8\0)4P'0!0|riW3rR۳cب<756O`ZDZB*1B58jh͚ERdd:m,BF 9*"#"7?z i1* p @=6`d ƻT(0~v:s$7U[_n]*kaga'=F 8ۤYPM2hQS *PXтD *d116kL .O4tb̓i&2n"$-`p9"d&VH<Ȗ/`ҘYhƌCt܁F5mJ.L5n!]LM^ @ @p p@( lo{Ə4~?wx,C̛?tukHm& jQh P0aHahbP 3R2b#h>*\! - 6`s# '/Š h B" bBB#2j :#-H*ȾDj/B{K (ST@ 8@3(*L*` "@ È#`-nmm6܈κHIsˍ$͍:9dC $BSt=A3 Q׈͹?nV[H No 2\XLpdA#Pc%l/0C$P1$Ԩ$P 0XIt# 0ȳH*tB 4 +77M+'27 ]M  @ $ `X3 NX>x\xbC4ɟSC$%95Sb/ 'qd;uYޣ2;US⃘*LA(dZha Bbmbp-0# 1M$vɜ>WwbjÌt$ч2\2UKs ނdoMcK@ix$+(2J P @D@آ=&n$Tih1ɦC\JSr(+exj=І&(dv) vdUAP{~_m!< d@/Ѕؕ$'i *a `\ʐC4A4@UЂ2wB=7Fx9s #pOMw_#IZԀYcHŌ)A,ŅՒመ#1 X@`#(0WfЪJ@ʀ0@Sqhmbg ptd8iqH͹ ]CfC$awClU8SbFP3\(AH ,`mʀ/D!HX/&dJ2 s-e 场!5^vPuAv0?7\ˣ0 ]sU% -*N@&ʝ5@H 0pq[`BVT,MzS@ ](#v2(Y 0t\!⣆'QPfoiNeyn8 > `M+-猛=!ݝq9٠_NC !-X N( 9vrjHVn Hs\t<@{@ o|!u:I,x+ `@]`jQ0P62۸m2Vd -xIPN`J8(R pIR֘ ]`.@[ >5x@/B p(>O` X$`HaXYιLZx{O0| ȍ]`"\ CLfhե WuE\=ys B i 8!/x@;F: P8 2` 59xӗm% d[ ڔ9;(P2C(8X!b, "9i2&"$1Ё*5B! !+"2+A,8 2#,ڋr>/, 'Y?CZ<AxGN?X(@PpYx5 Xx/hx x-`*Xa8ǃ+[R 1Ѝrs? tG( ԍ`$ԦHA0ϻ ؁0-,ҁ8hdIŹh8'x-'9;Zl1)x꣨..؂-(0@$,.'Jɂ2֘9[:SS쎯<Fx,]d{5(^tƵ&(-^s踗; cp k-"c,,=HCHP=<–mHȕ%s!i4p8PX2,y/P+083}q./ȂQ h #ۂ,h)HD4%ЂTn3=*CIiP1m?S=X,ph[<h@[|@ A ` ɂ"(#0**0C؁)Ҩ H9#0;H0؍ESkpl:;LyX6$,2{B-P%ȁ(z!Ӽ  #H'0%- O3p 0Q,؁%p̉.,',I2Ђ)!9)B3h镶s1A e UGF  8i Ǩ (/20'/ω[3@"p s!:r+G T5v,Q8eeSڡ0JDjmB K[0&h,p/p)) (B)`N"h @,`%#B x"gۗ#0'(M}sq'h&(-'+1! R4SȴUT|عiX (`F wҀ hKPD@ #*.Ah$ڐ1lҎe1OQl6N2=h?7*ZAs8oOBA1+(,"Hh,́%H(@."Xh#X.Pq1Z"# ,x{,$x(X)((ٝH\- (aG+ 5 vt$39@K8%n((?C6-i XAG:%tx0e?EhP8Ya%P&E1L%(_P?e"x"Z` `Ղ$`" `` Ё?I`;^S p%!(`&@eUyl2e)mA[ h?FP 4 @ Ѐ P5!؁PЁ1>3;iN㹚]6eocX(L[Ӳc9 5M?S $LxyNae;Ѯ.뻁(cP#(#H8_p)S,h$00؁$p p$%X)(؀SOh((4 6%؂3KߑR#JZ1wӰ(P:G+ p M `@@ bۀܤ@rr2e[+i< ̱2 ZS1kFPn8:E6OY3h>HAF"ܘ 0)psC@]_@,H,0 T,H"!x+&&)@r!h!=B$y)DsFk?H p% Q  َpX {\l{ 3JZA'0(FaGpHU9 8o>8 R0˜A)ӨЁp!  .0'S$$x(b!<ٯ >QAXg'0&X* ʮW`|%76 R^MA^e͛) 0 @˵$Q6I" `!(I Yh=s}i^nva*MtS\MД8>Z)-2p!Ё,fM uH"%h1#s($Pʁx"` 0p( _@p'x0H&"A4@ a>of{w%(a=P@  l mB% |g@-(@11ب wdERfX17 -f?FPX>W= $(i3P'Aځ ZtH ·- "VG!F aG":`a UPB %`AFmڸY#J8rqS 7pܹ? NϣwҡI=D>=$HУOO(xp! &ritYOZ5\ bm(H$=m("-ǧV٨e3eGf4+P&@(;Ǫrpvph~$XgDdԓ3=bPfYvr;Ђ0 ,P:a

P0x0<@.0o!PA B5BǚP&5qSfXYIE$n3+'xBrf80 <A@"'ix)  P @`< t"܀NP!O,W!T1 4*:X a8 DUƫІ6=!:1EłȠF,`H,0X? : <H  IB/tF/YLVmG,YdlH(uh瓫j$`8   hP@ tHHld@:A~6#$/K"sҕV`0CpĒ6e&2iRXKѠ dXԀ-p d N(T6q١6SX Jl3>HP"Sh*PX`r*P` @80gxPHBZMnlz`,; B@G t&!5ڐ4eϞQjЅ0 UpxဏI(";poT:18È- T$?(L,; (h6!a =Uep̀ D@ N`10 Rr& /OL\t]@p.!H.p,{J=d%9NSmJ!nyLg~Fɷ"jKXQ h,$@rV]x`p(< /pPADdX`p(#U^Â$ "(a!-Y/xA bCZՂA k`/A \fVI\nO!z0* %;T2X?c?2$p!IAaA|AČ`@< Ԁ@ @ \ \8l@~B iA 0 ,ؠ?pBj~8A\*J  3 C A,h(KN 6`0 r!\VRA :4Le'G7pAeV`jpCB4;  jfD(BY ? "`tEp2f4&$K4Ё62vjDPO | AX Z0HLXPP|\`D$#|AIEp 4`\`bRSЃ 4Ażp%$h+A G,N%Є5 -Bh0BQ*pOd.J8p'Hi R!Gp Zf - `Ѕ@y! Bܐ)pR'e֡ex]̐(rsM`v3 hޱ`4^:*X '#AiA0! :pа`y#&!!B80=5 IۂF5=.|NHS`%Dp!Yc FL8`@ B@ x>3<)z @> 9 ہ! /_0 >X| MDr. Bp6>xہ? RTUj fG@@(uea J8•P V+$ ap] ,t, F0qA T`3X#[`/0=DM45i3`[|j%&'ؗ!hFDa V? IP&e3hB!XbdW0B%B@  -|qpC8K0  (A iA|`blŃ ;pA 9Q@ H83ْE j8A 08 !e.ArTA>n'/ !X+2(f4p(!0#âа2 Nl#Ѐw RvuE1%3—~(o: PGӞl97G 6Tĺz)I AA~t*hI"(b > XȂPp0X+ G8b΢%!Hȋ`@x @œH  7`l`2 I~*j@~ vpk>*x@ nd `- b8  XP &rО))z@&MvF2x J>*n}ll@Ktl@M$` Cnn:Z Jˑh@] jxdx%6Dc\` A q 6o`~ >>ep T@[t .! `f^ @@| Y&a@J+X@6@ L 0 PV ΢L` ~^ 6 @[ ,- l`ީ@? & x`>L ^`@g;z ^)l MtR@V@M@t| j@)fG|wQfD>2 8*BaB` 1&J*C(D\8VGj6b8ڠ ֠r% (S 4!5 KZ&t֢ VJ f |`Pv` 4`-7Ѐ$`@ ,A RE \ "& R` |`Vn` @&@@nf l7' z r@STI HEZ i= F7m,{D% Q l  Ƴ v Jg P Ԭ,f}v@)) gUr2qw 3ࠁG+-0  25m)d+~ DD厈@NL`   |@0: (&{"!T_`bvL@ΰ0 2EFxAC| q f p`h H/. XL# n` ȀVJ \>~[`ІG ˌo.X0g1S`f·'ۘ ~`,`&/jLZ @ m\fL.C92Pz` hshEe` w Tfo[-_@wTD 0n`\@x h. ar xtN0 @(d> L0$@- o k }3tT 4 ` i` (!< P@HKQx>ʧFbgJ cw`-q@O 8 n1@ 2` ĀHu .􄑀xJ+ k .)ȧajFxR`At ЕH[ȇ-g6V@ J5n^r zD@ & ,@FDtL` @y-OEpx0D8)   zN@z aC`JH0@*@6 vs0 6! |  (᝹ rh mx@ =x`ncX"蘖B)SՏ@@)GOq3F `|I` Ȁ #etV/NJh'&-ٴKOPDT#皔o4 Jǜ^wף>`eJB.1: @ r XJ Jy .@X` D3ZLrO{  VH@RV. ( 6 rLF@E n9:0@+F(I@{$ 'v @ v A`H@h ~2Z@M6w.1cKz&` h@N'hrlNwbB|Ȁ H̓ 1J~ppTB`|2O k3icvE@ /T `#LWx(A@9}`(r@ @Ne\8 E* Z z l{.@BBK :6l`+@ WXL4 JGxrR4L*1JK$C*@81>J lX ir} :x=kJ`@eř \jK(NTF }@˃'ЛtK, b[2hT (@~:F/.B0Ȁh`вaN@QCx`o^mҠK906~3|4:St8 H`Jםݧ #(N@D _ ! ` B 0" `aj@ Nrڀ.6GҀ;.zd}oX`0;@b2xć+TCFС*VB )BlBfi$J)`~0BF+GD!'ȑGlƒĊ*\c8kL,UF)ȍVtPG [% /MP`B FX22Dѐ13e֔QӦ"8fH"!3&Ac 8B+ .nбƖ=!A{hH.]l"E1zQO^ T UpA>L%*|YA1DCjH` ]LDL"0 0 .U=A$Xq "xB +` )0B@) :aE68 0JЃ. +G8d!VaXp>D![AOTB Tp@&t\8DeAGE2#ؐ9FC 8$AWA4`(ЄZ !dxaj`ZhE萃 *,A /LiWkB@jP;Xqv[Gpbx_tBtv"*$P/X `Il|ЅmDL<1E9<`G (0B'lB$D̠G@y0@hXpA(hdTPADPp #$ )B /@L Ԃ-p ?`]91ŵ8|C!6aRB.pISjxflUi!YuZL 9 ' \(`0A UY`Pj!9MX9 5_FQ -"Br*pB 2PtСn[nAFaj L!+~QE 0!@"7(H|:j#EAP` P`X ؀4p  a̸ @PC Ƨ c70' RBՃ/ V)i2XA Z 'x! BbL e0 04 sp( !T$`p<3D(  `+31b|"W|OzpE\O/X" d ('8A^ M Ki9 $m.@MOl2  @#+;@T08>(0Ёl'k$^P@P]@S$gF@Jp+&X `%2%?(B 8 b,@ @!=XA pF4b@ rYX0 Hx2 h@X@%l BÃH N BF 9ea: `` fh pm%۠Ť!2ffR1$(A#O iҠ-X1 b@;7p}]5d 8!H31b X2 8XĦ i> bA u 5 t|C`(`XB^MP*4KXL1@hpACXP0XK G0b H nd<G#0 Bd 8QXHLh ^4@^@*t 'hDs&Kje d1D!ChB0 AT9w)mL:}Q 0^fѸ 5 ݢЅ,hay-9;@ DQ n]Ps1&88w8؁0 @@0&-`R _H*˃* w r8'@CnH]y| (p 6` E4 |@!@?Pf`c %Pev_@70 4D/ "6p|:'9) z 8HZ[0XB |"h Ć! ]T@ 7|" a  !0 B*xBFPYRM7Up=/_gD ʣ|0# K*sr|I\ު{ݻtGp-BX@ D8c 5H:KgkmK"0e@ K[J0N%!p5Qu!Bs&Kd|2PDV"%Ti:$1I]P"XP;"WG=NKr`&+0?U!_PS0U*bCMPInhnX Q{p_M@}ZZ@S`RBndrjgJ5p'SmT0 P 0LI0AV.MZ!h6% /;:E2d+`bY1$a:DD`500Q`Z dm mLU3?pQF?mkeb`p[[hNnbzOhLP~jB`r/\iPS`pNtwKU!av; gA 3bjjnSj9nA~Qp(h`w23d {&yf0JU`.a'-k@Q@aydH8`kG`!FHF6pUPh.T*#0n"E)SPt5K|IpJTD@GVNpH+;yFg0 V^N[=0cX_0Pc?b0590==,.K<@m J0cqs8p@ivJP[0@2>$A1Kp!M:)Y&pf(XwB0e5`+<9`I~uN@؆`@R6@&O:a9 Q0@@Qpfn{ntc>{ aPZ餔; ij]rN6Y\ަ&rO@Ub!Tr=VWY4ВUD`EQ< " Np;5B0GP]@@>|hP`##B;UP6pI3 <0 Ksf$ @1ap$6`b Y('AQP1r!U'p! p"b$pr#A1L"`S%]F$c3\7-;HOW F=m=y[ fdK awp>r>NuEA=xK0;ZS@IpP80<@\R!0!*ƒ!l0phF->kBp V#F`8C?@Gh=?!+Ke& ^`u-.ЧQp: PH@}h d 5PYbeB+U(8e0EURA71&`(fד9< ɵS!+0f* qd5.)`-yk8P![ep j`Moj9A\#"bQm{`}ġbU2rLÌ_L`rP[NjS`6AͮE$@2k4> v6%\pg+dptBTb*8LQJ6kڶ1iK9$Je{*$aR3p1*m~mO)05!;:)YK JD,pz^:G>S8N40`4^ [*j*9@0 %`@{8` #"rQ_1&P8+[G@f3`754:S[M!&ev$d<`>: n ]/KLpV\7f15,,l"9UrN0⠦?`6C`1#`j xE0aN^A9 0|0 (^Bw`JCjLp*`%@?, `(Y~'UGK] D`;ʄ{@jP >Ug!S2& tub{V0=0I5I $) p#B2iF4$5g_ MGP0](ĽaayCt,p0/RmM`>>=0( $PvdXI0'O[`x #ff O7䨢/`m`ිXXBH-; 0iN0dPNq<hPU@(F'0JLikp.)20SG` `([O` DV`@@E`D D !F2fb+[T':\r@p|‰)HB |c"C/$ 4x00ju$p&`B ,‹4A"ج.)PA *ab` 1H"":# 0`rx6‰(8b "xB 3$Mc74p&x.DQ8J@:@* Å0BHt'|(jb4hN``@a-2 Z  F‡X@"b '˂!p/ۭ=T$1=AC:(^ C^0_yMc5H #Ah( x`0AP" %z:"|Sd`9tU@1+:Qol44+ EX`T v1 ;Z./L2C#0)HA /TaB.D! $S܁B~P`T00 S`B`A. Z,4$!Q&&Ohb[4,hhB#(P@@ NAd VDRІ\@OAz2D78l A MՅ,؂& `J`ɘD ZT&U! Ҍ (!GHB V!PR ,4;@A'4 [X2':IH6hb Vl f`f0EZ`_N,d/A T!Ac-@%MP7<_)$Ԡi^ܓM0 &9A"*Q F\BbL xA2D Jpx ; | 3hAG"(8h h0( kHaڠ`N/@4Xs.0D B`Wm^rWш#(m/P t4#B(Be-XA 8O YXW9 L U ڡ,=aWa!r%2 eA AJMV pdrCT#=8p5 ((4VdH@@(Z`F& ABA3H5؂g X"  r}j3^ Ҏ阎ʗۂK uѯuKPbK9p-X +P nQ#hh$ýA#%HR:8U2!;T @6qhА  Ѐ00@}Z,C p0pك6Щ$3(-80ʂ!f; ;0-<X|$؁& j`IP6 "-!P,% s5Hc/H,xqۂm4,XA.` i'p @oS\")؍5/@3rW/j 1ep:P*$0( (&$(-, HuQ38 9&F0xX` 80 G + X p It[Q٤ў9;"piAȂ"2 H$ +LP0L:L"*!BXT Z&HC)v $p@+l @)7#ȁl) /RuqJ&Fh!* lk( !m졌H0[p:!Kz%PkbAt &p8p/Dx=9$`;&:H%@*ʞÂ,Jfr $a80gZ2 kRuҜ. %Xb1e 04pNtʁ023'`9 XM!.(:% .Eȁ0H)V-X/(K#@%Ђ.=X#p2CRPlA$-0/ئ0-PK};H%0!-(.IH2)BY3 #80%@Ӓ(g[%eہH( X+Pf #D( &,>k^&(;2xߨ$'p Ԁ0Ѐ52x0H=]Kh, 0hp8G #H9/Gh `E(b}݁yʁl: 03ہeך Ha)1V,hҞTk,0K+u 3 9H' )ѫ8L5T.h./"9/ 3-$:[I/` `" @Ue X; ;mD@'ZY(< x&,$%"08 5!.X$HJ@h+/hxJ(Cy%9Ձ ت,,H*p/@, 0 pEpR<`"x.xP㜏% 5A5 m$ĒR%Yfusfn,)|JX:M8 Z0zP^L؂ݰwd0pe75Hd4C#X' nkSԁW 'xP@'X&-(aR-H Xmr'.p I3CY3BX*&/!h*k?P*9ޜFh.Xxx/2Xfւȭ6٠S 3M)-`j>Ok΁P9=O n@ѝ}[w('MrE]6@/'.!b {ɫ(XH.K h hh Ѐc! H5S &x~,&X/!30.$`8 $ #P 0%`U/H/Ё4P-$*0'6I1),v#&-*#,a,NG"f$pEP4 $@H-0m H&  &Uo$XS@B)/P"K .5a$Pp@C _!p.(jPu\5&ɂIp+M-,X! qYW,T̀i8xH1xi!0P( x*0/'0>r*[ju⣰u[/#¡_rX$`$!)M:%h3 :H0&((5e4*!V8 #H  PeܳHnI@a#Y'0. `H| x(ܹrw&؃%pT܁=aP+.؀q{1m:(08X(kU`g ł xq( Px)(,P$-Q1Qb1L/jnjHhℍFX%,Az  +T&O(9#3t!Sƌ1_DbҞ?]%)-i(Cƌ!_t82 .L%J$B$!$A!$,rc #D|#ɖ/`x&̓*@FhD6lAE+SE $3!,\7jЀ٢Q$h`hD2Ji"GKa6n7w -3X['9, &@v0H0(0B@ ? ukkiR;5c&N]h*٢qFo7Ѓ`XL|kQ0VT(EC] 5pDEhPeEO0фvՄQ<+Nz^ zMx߷`pK -p"M"}t|Fơ!pE[Zp 5xZ̠p- .d/ (H pL4  @(,lxp$`؀ ,q:ZM_P`' 8` 5~P,AD##a{ߙ˜5-RHl+jiB:Qj/ Nd OI# @-D UѠ9X& @Iׅ,T5]SKp80QB00 |Z't0# FAl*#P '9A ]0NqՁx .@BDTLa `@ր4+:PJ%,t <' ,B "P@Zh2Bp vB @ Lh~0|A ( 90` h\-4 VhBsd.$mZrK LMiq T:#) S aʧYVLCȘ4TT iPS0B"#HSOY2 Y d0XA_BW'?]1}|[f>d QȠߨp ) @.A lP\'#N n 5?`> K R7=.&م!+0#3x D 3XA\Ȃ$+(C}$`"؀& < P d[F#4 aMT7 7Ѕ.z| zBXq\(VTɕ(eb&l| k1b~ >LRV.=b ^Ё(+0 KwpCh%0|_j 5 `0Cc;anr!/` @&p B:{hMR4A`_:tPaHig ;8HR&0Y^Ȁ ihQ@0X,eHN0 ?*C D@ p@(0$@ЀHU(C4*ax𒔖! aBO%.nmm)6Lze@#$Su48 ̷ʠ-*& 0DhbM lgn B0 Lk8*wh.|!AWX<°\H$kP ̝p @0 p<ΜlAЁt$ A } Μ: @D{}ODAA Bﴉ&i1 Χ(.A@ԀP04DPyJxS>:4ʇ9Nѓ!f"Սc- Ā @Ca4ke^\\͒ ܀(1<= ޺@ lR@tK4A Jt#2 N8XdVOA cKH!@D\ L~U{x yA wY11 AWq_W|WG4kA[)AW`AnA, '׀%j$@Z%Q2ArhhaD~|hA0\5Ѫ Л\nh@ h x\X$Y]v%l&ANDA`` (lTN 0Zs[$ K䆁,b1@A|@܁LT E!y.H -,_ȱ$考"PA h{`Kg q4n]90mΖyJhAA:BQHL: UgAG+h2  @v؀@ZL_(:zye/e%$f@5 (@ dˀ@h̕MBq|qD<@,P l2r[}aAO]V}ȱ@ D $+^~@H?5zLqD1ED1AUA4$V2QQP[$QX4:|E^0Xy^V]A[ `8 9X`mzE @TH ]2FN$,1@\0 A@xP?=KGA@ \LJA.ݓ8W@ 8A A x fcD9ytݓ Ԁ@gR,Q[xN m^|@J$O:Z* \Y `aG@Y̭S^QYRQ } X@x)D=2xK 8p 80`$D!6 .n?x1䈒,_(19D -wpAB'G\H0=(80"+68 SF̓%bܔ 91ӦM-Gn@!GtN8^nܡ8jI4jڨQ& ,ClHc"mȑZ9j]φ% dԜތƌ0a)chʄRI$J$I"Dyʼn%G "dM F D/NB ,  *XXA5#*@B$$hB2p 6`vPB #tAqQ8Ȁ * 6$h $h>0BXXxat"&|O%B KhCh x 'JB,h@nةRBl)L98Hˆ"B@.,7, 9Ȣ#fs,h3c<(+2+563c65̂PuMC9cB~h 6B 0iøB Ѫh"(=@#P .v( ,N ,8 P z,7rE34Т]X6Uk 'h!# R@.b?c6>ZA/ |a< "h`" t  X0jH@j xAH2&YN"~apD(`B XAMԌ&z 4h5"1%(z{kP9h"d0=DY !C=Ɠ۔4ʝ,]4\xZ3GYf~A8+Z$hvὖ[ Y׬k*d Bp8B yM IB̀5pH.(E,X$@4J oa'`8z,D KO;+LݎX4o+ kBTX2)H&`0 vP@?ܔL4[` ``l}AV 0,  0 )xtb7htR KI<m Aŕ8!utLO f1eQC*~a&Ak ȩ4uK@:xïb]((,|MRF%0 ϤR ZhC,,aMkҀ (0m9`HA``3gT4jqC``Ki VhBKGHBՊ>^K :8Р0#uVօ $  <Z`zn xdFޢI9Vv`@:@H.`a2@fM WG-6 l`dz`t@kpb j=\@-@ *,S:=>\ r`R`|pj\I4$Hr''g @ E[ Z ]  @@ `( ~4``6J1>PU:eSٌ֠N:uM8hʏá*2MTh, w6K p@ P8 ִ ׆/B]` ,"xm8Ġ @ "roUt@p@#s6Zj@J @M ^ l8#WW. P14 |T@7^`Rdƶ6N&J ] n>nY   C3M ֱؑ vB (L2h f8 P!NO"Pŏ:%+6P}pBCl  - {& nhM `'P ^U񢀙 €_(u@``.`2@D;*kv@PR@ ^uPDI0$$kz@h W"v"&v UOMFHHS2Y`HLsBQ8 Ri@- ATVڴ @^N:I12RuQu"0b $cB i,` l`.`Jez \0&v  $HbuÀ @g)̈ B a+7jCA1&(~*J@o`\[@\ 8)2ie 43 e!!nn` `Xca A9?OIg.R-uf u1(56+CV*q DC*‰#VWS5B CmW42L Ό N ' X:, R.h8)dbM+L f?4uIK`R`k` Q$d7r` x n@@ x[nlvI 2[bLTc \㱶UXs8Ug-Z]s|de`6# z%hEԑZtHFN8"c4;6t,.DT;Ed-$!(Uۖ_釘&#MzUIlA >`H$2v ~@<9&~ B9iSN*` @*r?2M @M`b$hg $| ]B(\ا1gns`FrB}Nrp.Όe h 4eMV:I@tjyzړSP8tz"Km4^;CAʀW= @)P6K9me3mAp v{Vsz- Ā 8@2r{`䧆,`8 =~1lS m1I2 Dz ?j<4T 58֎ئ M>21:k8`F O%``ނz lz *V{Uy ]ڴ2Q #?? 1H~1fLc1ia0;e1X . $ WҔ[`5+hnyښ  &=* @ZB8NU@ ֐ P :`J ^>@ -ffS v.Pn ڠ ,i<بPěg3 &|@hb#Jr̬n`d&j;& d-  ~G{^8:;Qd&6KClT jETg. =NzC`z"[w܏*1ux4+v6hP4 e H LxѴ.:| Z+~Ĭ ˚ʕ=4 zޔa aCڱ Oso`#N : :N[o:vтCd[<&Tr jh>& Rd)jji2  *\ _{Lݕ 0MA|)ݽ=:ړ6 6$@c); 5X?t,0:C[ $Ȳ6 .38r5 #49x5~جm  x@HbP$pѦǝaܷ`1<Z :x ̀ 7 yH)Fo }e}4TZ*BD`5ZCv@n{d#+S @db%ֺ~j@2NECv r~D dc#=;gm?9PaES];+G$5: ̴C n֤$.$Tf5k1M4bȘ$J4rZAEM-M8ab,U0%Ahа! 2v0a6:$$ 3I!4sgϟ{G9pܸ 'BvhㅌH|Y,Uq2˗/[qSNkAUUth3f?XM~=[q/uFϺ:! $GGlkHFnt$-8Q^QepG-YQU`` )؀C +A /(ASD  $>`׮şNWCӼǔb z"D {I zPI, a`If QV핈Eٌ I [؂5lYPB`&GPBd A x\>A t@0 \8b@'8t7XA XpJGQh0X!8t `9f<r/~ (" X vyT Hp  p@02-lA~#T4ȒzJ ['c'Oy@;B%}eAZb]F)È/=L!HF>VIv#-a pA^Z2 0@`=-0A& D | f@)p[$1M5hA b$q#& kp%-&(\P0 eX T+B(*̑MyFm L0hhV0.8 UhB D0ЁKt` r-A @ 8D bh 2@T %,>`4/Lh %`#\ۓ )A0)&vwlB4T[|$@3@$ XBA AAt -bl\ OqF*˥=҃F|2{"/BV!QKW |RX/W1(0   C~nq1ȔDMbh&%]]?dFBQb+ibr%P a  a:?F-0^F`E [C FQ dRXHˑ+69Pz+AJ'Z`U@UP\S#025@`F0%6& 400.2_]/6A;0PT2T8#I*f!8vW J4 D~ =iD.Qdn^-*ub=c"n""f)2Ax8V1/bbe ]p+}+$n#IW5`u) !)Hf4EK@?#xB_>FvrfG (97X`K%z84P/7l?P> j^?A<CP>Й09Ji%Zd4 `͸t(.(70Pq8kMsD3F%S}4pJ;|{*bK-R  !` !3#42j2r3"EM0eCS]PbeQAUe0$ v3")pw)F U#<<'6VJ0Hp:clEPC@_eeALg9>फ׃5`GEt;1i< @B D 38P9u92y%HG:%( @#p4(pgb5 8:$C \ Sy:@Vcj#DJypT|- ,"I1ϺYAH! !qB@Bnr$O59P@ @D( Pd*mE@ pJ:U+rN`L'K%CjB`Q5?DPUp?*jmtRX}COPQ:КE0jNDi;I}6m9;&P*DZ:H?`R5n\2`.`+}fZcSfedVwWz|q' Ѳ/ 2X"'Y^0 &QL'n@cY *zdn.pLmU pp&@`GЄ4S0GB@9P=ΫM Y"&S@0EY:`k`3pe?mNQ"R;f 5uԭŒ/8PPkN.i#3`);0,JfhN&u@`_S )f,*wc(. BC!w0 ⡮25?bB_Q0,!& SUt6P(4p @?02 t:KL}(%tz"99r:JQ2G5AH5><bBDEj-{3"Z@zVNcU'(.0O`]KpD`Ar ' @S#1sLY+H77P]E ?2~z^)Chp$F 8pv88WxO`S@n<f+-(Xi`,0?%a7U\`1ʂCwWͮkS!"S!Gd0$"3.hI"ѮVK@&@ `QdkT0T3)p4uBqE+ S!(3`R!9K`,F)P_i9>kj v)2b;f}s*:C0 tw1ѱ}e17(?˻H5{c%y.[=H#"nSJ{ɊGY4CI zOd1SaYVPW3JqEm`%3_p>4"(0YqW*0\ *B$68@^P]H2DHi2 P?$}0&"a@ЙBе|4Qa>Qy[e,EȾʩew r`sB8DTt>7P88az)4PX0^I9|;R%['uffG zppEpIKgd "EQ"w QWṼWJiE9V m41%Wx4 Cy#^3#.bE/R$V@%FQ_1Xp"B*; G _"A&}z#IPe'hB 5kIc :tq3(#!MDÅ 2fX%/N @xؘb9j!"F81d*Zv!ӆ9]6,;^uڭpֺڵ 2횁4}萠g)+`A#(`ȍ"|P$FjȀ #F!FscĊ)D$h谱D&`!-XI%ɏ@ YdA G'\ܑG B3gCH-k.Vc#JcXQÌB,0"X"$C*h" 3И ,B 0@ 1T@&P*b $8" +0 -(Z#P.,`bxf^pahC %R8*-J +;J BA),PK Y'X:"oUI0C̤b aTl OЩ+e"<s˟:%@zS PU J(8k`8 D(6_PQ̨H%J%DP :@)AC  X!؃&`cadOpr0 ! R#T ]p "Xa`iB jH:`CKLX R O@$ `vz `B ,[NI0 _f"(4&/XI$@ 2 kd=~+X<B*ZN-˴(9<,kTAk14pԛOۋ?ق%hC>7.xʂ%;Ph( xx4N0@/ .2 +H"`{,1H(1',U)E783療1@1*;d%Г0`DQ2X& 2i{29(j, #"   !,X7Y8D*I/QЂGиF5N(D18s*h;Dɵӛ5HT:+̳jNk8_Q  -؂pp 00*0!5=%81zAwkD'()rT/85zY0B,z@, "+%5)(فߊ!EHK|"%051" cFN0*:[Z8-#0I%G3qK, Bqo=̧ $;C->/5 1P(u=u P\p"!1-0,.!<@- 0dK #M.H…#""4HSj#=҂;$JEX+b(&ȁ]aG * ,X-p i.ӓ>I¥2Gy.ЁR:,xx00sbк^*3)65\kyPɣƶD 4Xq $()P 4H6&<+X,/?X#,!H)M 1N?8$72x!p|(+!2W./,L2%h&8JQ &t!,`czlsև՛ Cvp¹Xg2ȶYᛔLq&,O,$0,I"Ō&nЁC9jԔɓ**LK&ZʈD?x'7L 2jڬqK.e '9Q2a4 {gϞ)7K$!C FTaD "L|qCE1R$j98%H#N B?tq"KD 0aʔ1&R8YuˁӵStvtCgMe  ҍ="͸ ˏ"X|iZl!j1z(R$<$MЬ13HLL]TJ$!JLkAmTSpR29 F8C06 .$A -`!C @ Ngqdtх DYDKL1I{iaF)AC A qDj\|Epܱo o]8FiYqs al@ĚX`O42؀`ex? QBQE3x C -E)!`mk !C ,CKDqfuSaVUj$CMX1Rj1r aF^hFA$CQ]D&D=WE,6ca\<ޅfu7nu}HimwmQZpha*Ļ &|T Y l Dn_X[pE"GjC EƼ%`B dy I&@3*H ~P.AA 8,]0d 'aq8Щ75pC&`6x |@3L`A >Alp@ |Q. BT3 apmp6%CA l$VɆ00XP #CPт$f [ak$d *iS=pᣍ T7۪9p< 2`@Ck![y: PP5UA J|1i$lR϶AXFLAdx zHXO N ,I8I,U#!5œ,՜C>ެ FՌ@AA@ A@{(! @d@cTA 8%DݴP @ R@GU,"`M>RQX>U(UMŞGX, R L\P0E m @iV9@" Qцe8klV]KRUTZ( y@$,DH;&<FpATA0@HX9 DA}SJRAi pAaH AX($싞lEO]AA8D|TVHAvUEO,nc[{LB|"K[2EБ8Oޞ,AJZ!xl et<̀ A ȖJ@NLZTXSU@ʒp58rnE,^NPT 8<@@AdKG lM(7nlT&م~4&-U (;=Xx[J @ЀzD%'#(GTEK.AOGqEAm\BELSSXGTq!˯G{䦜eְ{P#Lp!na(F 1UALeD4@nH^)Ms| 0<pSb$" aZ(ݜkDYX@@@(O+a , ,hA8tr)eA6) 5Aeɰ^ZfTpaElp"=;mS @ #%LNc=AH'eLHDXB$((^$'G]ߵfE蹲Y`MN%{O{YAe[Ͼ+1X@kHZWYA @bx%AɎ>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ222222222߀,4 (0@(@EXA,@!?F?tX2 81Ĉ#)9R% /` TN?*Du*Bt:4i@}С ]+UP%(R8a" 2r 5mq6dȔCf2eΜIxl9hVf˘7ۘ#6tZhզ^T6n*TTq oX8Y$&Dlb%I2!E 2D$KفF;b%@r 5|3̀Dm(T@B@Kp@- E4-X+TqVz!HD:C?$ADOHH0iUiuGWx!S rRAF[R"XgVQLDQsKPcF!FbFkf=&heA`x!ee1iT:a\FkzTV OuUs%rI,M)PĥW\]5AF>!I?D-фir\QMpC :CL`@ @ \D ܠ ``(pPQ 3xP EDg01Ql$]w]:EJA qS񆑠!S]݆%YVY%/g|VX2GYxAEYwgZd0WlQj{*kkpFe :[eiԆbvedk6dW/2JPnL8K("Y\WHDRDb\QQ^\U4aJ) ?6HX^Igbl=`CqQqg(F Yt0p E 4Pt6DD^xiKD`RXz*A,2d#(I6YlC% rЃ`D~p%X eCW7 }؂媐)0Rƙx! xʐ1l! N«RUCЅBȰ'9""&%.iy,P!i]B㪐HR HE0z$ PM[4TF Tehdg< !@@!H \" >  ⸅BKb$ A+Bn)a ) kŰI*4@K/& LQbe( oC! 30r[ Ne+E@=39}P57U(u !C9ĕB$6zB"8)$! ˹\x9,\!k.04>JdOda"^*d2]pjJSj; %!XA%30@#"ؽ@,yE#+@.dATo(#֌E+k" FBr),VIOXSm,M,L`aMLŔgEJv)6ƇI U1a D.rk!f,ӚJjTHS%gq+儾p0ՌEKhg%xL-/ PLbhO{R8D =8 @ȼk ()2TD¢ E (Hq>S#9a MAdAc8BDz4\a; NjaO jé>ܥ `$ݺL }7F51Qd)#Ae!v2daRLd*>AaJWӓ&VJ(spXqY]%T~TBPhY?Ḁ* Wڦĵʌ5] dȗ 1P07$ XE 0"J HB  0 ra,-6g(8ȁ-H42[&pH6di h@Z1A] DշQ"Lmj ^͛5tSê]# 3xݎm F)"jƉb hrAd!> 9Uvpp"5AAE:H1eYYC !A iWҥ2|22&,XhBp H Q@p]$ l@b 0 "<&m8B]pYP#=?=i TPiASGG*b=#>P.>@x2leA$jfi `FL\gt=@8c0JQ)0" @Rri @ 0|+7Ȏb![{p<@G`%`^W;2W!#)}Pf1]OBz1adxޘ]f6o5T)c~$[fu())!UrcWmH`hE")DRt<`G>:D?;pTQwR2{Wb|E[-U+A(c<`Bd0J/xp pp"6^}$66oP n*c!coT2o]Nd**t #$qq*})swy 2/4FZxPLuH1!)GnsQH4iUs@@I@*G)2QM:A`푉8:<27@":jnU W5i[(zeb1|b 2U5Ah!p}6WDߧW6[/:)8d46x.W27sdWdz@*y7sN@`A5No,[O劌j6\IW)k%3b*&4SE(asjT^@5Y>p04d>Q,LD>>4,s0I279 "X$g6o(CXpQ%,Sb3$R@#p=!HKr^  =`5 (o3M݆Nu)%fa CbZ/KzO*DX%W*[T[65$uEL!6DOU& %fD^i6rfO}E"8d'2 X"!- HH 8W,-ْ*"^p$Y*75|ƧYp3uPPbP `+gP@=͖Ld! `TP94n^pW-25kbs(7EvcRyW"S%Z5[c2ruQ~h7H riڊi6/<PTR(62{\Rg;eJ1yyҘYhq>iuaGXH@n=[;O¸/6NA )#kb([@Ui@ U (@=A@``p0#Q"p@XP%_%D*1v@cq$ Ty3gY%A3jY7UYO(4<#z ruƊ U'Q$VDPP)u;(BI$q(Dt^P#"Q4j;qnDpz,MP~i.=.R%\͡u3STg2+E[[upT/0E`m_eh%w'0(0KH-vo>í*x@?(\y3ح D'̎1ʭD`pHbu@D% h7eǷdQN0+6k50@]lbD[rX#Q|UDg(xC)z!Nu+,'j@F1,BjiP\!E6)gi 0sa@`!*Q%JqY/  x#0!`0« h:eкo5':d7$s kGqMU qipw ]0!P+w_0Q /@   'PWcncz@1NAq9 C]b!%ZDA1bs,}o`2\@v 6X)#7& ]@1[66[gXfuÐCi$rQ{KcW-:AC>qCpFtvydC^qˆ1CA ^h 0VJJř00JS##@wK@s }MHL_D?.o@K(yŭ}@Up ʖ1c̹N1d֔rdȊrPYRɍWԦC"DGJt3mΠ]3m [@ 両E0`@ )08@'JX1b M|5f_@-]"a>t*мŃB2cX =`J^h,ʨ$(*dD", 6R ԠrZ`b<\­P*1.(ʧ4諮2p/"2/&= 1 23, r0CҼ`h#B50 С0`( 0@J!` X7^4 9ժ`ՃDâZR-JE/A =b3 $9a)xփ龒CȎ+.kl l|P‹.$ -7‰+ñ5 ʶz2CT!: /"j D1l N, 8I j!Opd4HC*P`vM 8  dxA B8'L\AA=CB=B0lR2m <2$J2`2h=59" ,H+2ʠL=H$ ‹L '#+ ݈cX"̦( L(\ Gpf j$xH p=dIVDҀ5G o0|ia,Dvj0w]h'X`#A bЁ@TS^#2YU&#G 4?4"s_! /!xw B6 e^Z 7+=N8D X    <2P @>4U,Agz'ц+P bR%%Hx,`nm`NDHE̴ZH }(kH9B @/ D@p`;j. E@Q w},+ڝ]kG1H+g(q[r!:A XgPz! CNP;%!am8L4ԕ0 8 .@36 0Kn3 t [xgX PmYbAYE RB氠, FfRPVr}`;L>]h8 P$ B0g O W؂_D}z:0j%9!q$.D8"i( (ZЀ ` "j3f|k=t [(H,bCGoFْ7`#RT@:̤W0Bͨ*8f 0prݼ?2lЃ@*B Zp+e D :|i =P N%.KZ殞n Q n5Wɔa٭ʰl ϻ b?(#D$ɭC"7K VD$q5X@:" P + 8 *+! W QxYx\Vp<}1sAiU+QٔWİk% APt,`HĉP^{D X  x À+4mB x% 0 xyOCG #m-48iU>(cd1G y =! 8ʉ@s7*hHMij[!8 %p)Xhx$ XPd$ '%C$&@ &P‘&MK?PP8)'hW^+ xdE uh Ȁ xP< @!c' ! jO2Va>8ʀ#[AP1H^ * "۫3(X ( AW ȁ@a$`%0CЁP`# p0[ ( cdn u!ȁ$](Ey,&8ЃHJA vHt-Ѐ `3d Й`P( 8>c!ጏ!7-YT(@ݪ@B(AĻ\s2Ҕ 5^à (Ճ쥲A  !@P8V́ 1NH"p8؂- #1@@ #(H#;"yy㝨 ߠ 'Ф;B(H `ц@  EQ0E2% yL1! h-E$) O*{<SD]s3PG_.'.Ə3 i+ O9j(qwh-h N ,P8g%h" E 0    "PlfP'؂))ŒIú` HH "M:>D! " Q 0 rG^Eg=+-'u-2'<Ghpb2Q;1ғА4ڎi(+iЁ$p"؂4@P(1lڅh Xhz$؂,!y ̹wGNf}I'͂- ذpX\ץ"06l1!hޓ( !냘e;* آ2?Lyfn8Etb QB@.@(Yw7x J(!@0]UU*0kЁ ѤmE!`ϓ"|$x P!) AfQğ6e7HeYnݘ`FhZ |`*"XEY 8P&p<=08 & <#hA*0ʡA:'ylnC!FPVn]+]5NFch<("#n>~F݅pEP,c6?8fr]au( wg P*,0^v@+=炙w9ժ8ٕ$$PvGxrj:[U6g 1РBᥝ H`5"= e"XcIz[Ao !A*@еDЃA#jFI XEP/ #(ui!Hi!J֭EkH0&$8؁S3!iށ(0  (D`lHH,V u2VƄp(η jHV_Iz6P P&Dۖ+ Ȁh 2P(>X+86p%=6*=A͵ Ҹ ;].D)G]H+C0xc[x췖P:')tGZߨYFY`i@J׼l $H`4 (P"(0 @a>HQE (;z!fNJ4rQÆ?]K޺Y>ȡ,e4!k@j thP3ODR(!Trѡ<V[oetFs}Tc .0t :PC 3 8P.x0,C !1 / 3\@A 8Ah0B Fp +0CGDDi a!GW].VaE֗jTrlr]rlHzDE!T@Bt P@<<0A 'C0ࠚ P?p ]\7ȀBu`qFd1DtD` 3"$­"wCH$IE!F^[em|نPD\C E@/p6P - C )pC $Q/@ 0T`B :H&\0 L L%d1Qr0Uu9,\ U͉]sWؖrY#PX0@@@X,@ 8 A - 2Ѐ@ ! jL1_1:4lq]aW!URQFgLj"0ȷwBz0G *_Go!mE!m1W q8䠄& .pC &F@  Z2hP0 ^0 JPV 0 /. -VjPa _Vĕt.aU՛\?N_䖹J.+#6 /<@4ЀPqhAp#(`r H +0%!90Bx! D+K.,Á!V[уTZ8/xv`B2 NѦW/! [HP^PG [bOÈ2! <0GD8~8=( UĐ!9 ExA VH±T_v50b@% `Yi`Ԩ'HAz@#QҀxzXCʀ-PE@&0A Ax1r kVP3 x?<싮J'B1T8! @PR@(x HEN ;r C/tPdT^8 P5@ Yc VB 5 L`,\ rH#^IT=K{-%$  4PJ ENHCІ@A 8@' |a KH e0-P+Ep 8`6d`#8f4ް m~1<8˓P*H }o 0d! ]B}ư2 M(CEW!4~3KMD ؂ d5)EXAb6 ʒj" p& &ˏY&@A @)x( v0Sp.#@p_ t!]PT{6Bi@]xZ4/v:"9k0\ T  (2`AƁ`HV0@ ,x$)K$8t@$PF 0#T@|hz0B%$(A `Sl`EAP%A M~]AH@AAyKTOxG,Ǯ8A#y xl@$^@HJ@ @ @,A  @ xJ0 0! H!@a88q5 L M"i[8m]!8_[[$ U h`$A`LB$\%"%TB%X7Z$L6ZB7V%d&pc8v#&X&@&d6 t)9<`_50`` #GxG|(BHA 8@Ԁ 8  X@,GrdH s1tW A \H @ @ X xT܆ @@ @(lIlQAt|dш lAW("0_m_| #DB%lAȀ $PAHm, HAXP$X%H9^&&̦B%P%f%8%0B)!"A P dDY\@b\=A Ν\Kpxx y#XVC,_XUx `A `&UD JD,A ^ L@it@ P @ x @ YL]xiBA@  ǐ pU4G^0GxTSFي9Bl̀ T< `.bc&YA@ؔc "uPqIAAd 4@tTL @l  ̎^HA` F IAUtA}RqP_~L$$b Jc t@ 8A O ȀNnĀaƀ TYROM%@H @ t`AORj @&zh @ Ё D&Rd$&6f@(J@4,T?E& ,$lA!LžUB@@ @@  lG lu" @%m*4THp`ĤJ%@ l+ߊ~T ylyxG$Au  2NWld ؀ A d )L\ 8GA]DrAac^5n8R(^|^Њ +bm,*9`%bT@@@`H\@T8#$tp@ DJApVdA?N `xj\p,Db0W¥$ @q "@LUZ Sib0%SKDAg̠P'|d?r4bcڪB;|NO6* 0<.Ɏ"G^ EE$`&t6AE3@D @x 0 @^9r , ,%0BA`& # 4 ,A A$`@Ԩl DTX $Yf ~Byo5A-~}NxK/b"HAA x\\܀A @0N܀@@ D lAk FϽ⭭xȀpl{(+^x1`)`B$?yehA xAUj `u* W]$̭@@ d%HA L@dB ` 0t3x( PA @3%PP쪁DP@t%DD'>A &l8n"`AApA’@'A 4A" V HA TzՏ#R xlkYA'͎ar,|g`9Hhiw*d @ e+_ B@IzJyp]xYr9P Ԁ AF* a@A m!-$Ar72ġ[{Q@pBmH T@.@nx܀X8 d@T&,AnH0AbAȻ%$ ʪV$ xA$ %DA P@La @F_3@, D̅ @@ AV`l0ebED_Aq(ro t@4+Q PՀ{\@ pnp rl!UQABd"a2bHzDR(,&hࡂ5|裈!28'ʐDrB 'њ$\4˛B:|dQH#RĄtㆍ1zD#G)RRCpnj=\Q+kd犗AeӤ (WĔ)f 1`IF̘gHi#ʼn'VA -X̐1#ƌ1d`!tN@ dD9D(r*8BdAE$t"`8"vHc = x #hM )%`A($(vB6+"h"4IcxPbC%8"D(@BMt@T`PBXvZ!6*@"*BGt*2$:С *. .ph ddA~ \p" R"P行>8c 0 )pb1Š-H#2HC 5N 2ν΋p0J(A\xN=PU~ZH!> Ԑ %BD6TDaH.8чw#!1)-4aD"z %r$b! 0,鹉8I$2LBD A !ED%vPa @!:0A*G(c#ژZD gXw ,2(" D="+`bb :r`5Bi#~ʁt[rnfHujhx&`8@_ZX 2k#5԰Q52! m0¾+h)X P`?+ ATЂ?+`A 8}J8 9 Bdi`DjE%  ]A 67%T! 7Ap-(A>X A. 5D%|@䅛]Iv!( 394=sFp ;}ڃd*.9B5ux Xb(D/&=9=ROqevAHZxP!` .Pt舜OBAnP"QI$HH R';]F(  dHh ITB 'pLji#ڸ_rT@4B,,A 9((BtpKC:T"b BLB'nЇJtfH\@?4A \ T$dA j@1m(H; "8AVX,. qD @6HApU#ԠD""% CDv X uT<  kh# H %B:@nM tA `!P *3P Z`2 , x  xJ8*/D` L@` ޠd  jk5 ΀x@ d :`Z@^V@l x  we3~ۚDvgA/@ ~c6~`'f SԨ:e #e`: |@f*T6-rWnbB@"Wu &e @]MpDR dCؑ dρ@J@.2 @@8$CH ʀ ă/Ԁ@ 0@K:h`:[`F j UN%, 4g`@ z@ Ԡxv@ (`l R @ :R`I ^@B`L `z` @ 3 \ s#I   (:;bFlf |zej k#@JkmD>N ` P8g"!0B496 D&,k<*@Rd 6 \`6ԀހjR0 @t(hG`TpJL`oA@v& d`:@v V H C9@"D)`Y  l`IA T L , < ր k @qXn@"  j@g8 WgB` QT@;` 6Gćzm(Z^ |h Wt`@D~ NhdTHS DA @ 6 @ SAfdF9/! V0 h@@R 2@ N Vy@^ϠT .  T @ `FƠ HD 4\YeH% ` tR xłmk@ xP ֋k:@Cu T y@ `.@Hd` Ƌ`f0 Gfn aj@ "!t@VI E 8 jge  Vδ rQ R EsVT&MX5Q~@ADjVC `R<@A:Sww R@4`). @Ԡ8B`TR V G J 0` >FNf &s8  e>r`k+"vpl0F`VP`p@Kx {z> \X  vߠge KR r 0lt ʠb|mSDV [S) h`*ɧ6t `NV D: hxTH`X`wsVn3d@X 4 ZHADʊ !dJ:t6@[fm1 2@` `* D0 `X`" T J8`.ˀl@ Tr^`H `@SN :@Xm P.J78\ B`1a8( jY~`W\d ʪ wU h@@ @^ @T H 2wzX&X.N` `Y`3߀^D8e-wÛT FQ+IQ@AC8$"l;cҀpAA9TP ` FV@, Ҷ+c.@(@+4 $  X`;`H:` ,&+>L.sD} "XK'Yܔ_c ]K<<8KJFr@,Z8 j Ni#> n`` u v C`BN@0@ؒ@PwM ʉ @'|x~`)@;һ@zDw6<6bkb/]`( & _  Ŀ7E deK drCSt(~ t.` *6. $(@:0n Nb ` @, [?:D"@0*|b i΃\@Tn B]@P4@~z &:`@ ^ t ŖHp\e @w64' o0`3`0 ` (k ]}O ֠ @vl;N@qF6>r劘4j̀p!0HG /LD *9 "t$Y *䴡#GZ9i蜕f'JX 'TH"9bBE cEE`"1ciO?}`Zrd>.t(lF(a!#F JČ2&>tiAA#cڴ)S XoB;b GqHΏ*OHtAB" 1Hl!# +: @,p#䀃D䠃TԠ 2 f4`C 1@ &u &h@H+BFlHI0tqENF # D =T!DЁ !WTFW`dpDEHؠTE@D/Rirz! % ,W,| 7 0P 0 1D V`QM\iy!/h ARecDaY0ER0(8Q0d,Q iVDIT 5q$X! &99!D@ H<`LC@BB(: ?` p'| + 1l!0B`X@ <`,Vcqt@Vl5E/pEPEiAJAz(H"[G"RF kȁW $uZ`ؐ_0 ~]:D" &@q. 2|JFPI,Jl!gFV $l1dD^,1Q `J`@LQrࡇsAE ox@$da i^Hh`(,`c< 4|gP0:*(Ȁ( v5@t'( =C4 l ,x@ = 0 (Hq xб#J APA 6@0E C#0  > JHC"$A& 8I@2o,' J@4`! @È/L =#E p+d B 5QzM\sC8YLЅ% H` @(B, I`; `!&+ `B .P HhrP2,GA~y Bp -`t4`'{ B; >3TTH `?8*mB2`! QC06hWLp! @$P MEk%6昃hBDL8P,@B 2@,h Kk+@8)QЁ.hA @u(Hk*i Kp 7="a U \ ePCP$5x 3,tpt` i(T 6Ȁ<X~Z@ '@جBp80n i` 689&V kBd l g@vl8Aj` 1XAO+p!Q] mY,%.zm :.p}2D` 9d!A L@^0+F,&73 ! c\! g*$PPd x"%}pte +s1np8Q(@J ^4aD1x } @E8 %@&`XP & l]p&8x* B&BЃ]^=@!  J@Pr! DxR(xF^@A5l KH$$Y¢"x Tp^%8 g &xЃ1pz!A=|t~ABY0+Ő+,aLB0@ W,/ 4 B v@t#0 *Q / J|8gHrjP^X[@*P`*PgP0 E6b2JQ`Q\3p) q9&p/pXPnAA,.0n(01@*0Zq*%09pe V[J@J'@W  pІN*6M ;p>PM?}gMpި5k wrPpGko@XsV0 Б ~43%8sQO+qeTgR9k0$K11;GwRc`QYLWU0P 8`JpB`|0sjI+(iRx 5fjP$H7B< B`!'QpN|T~*x+@R1T2*20K<& ":C!(ops]!!T0*K tiU@m!vj}f(OU`pg/@tUg8/?D`044p$7М?@%Ѩ!ԈH(d9!WE0h0|?0AJ{R6[PC0+Y(PE~T6Rp 9mE?DPWPr`x'UeF )`0<[Cp2nu*[HJq/P`@gx\5 }L> 7R#G3d`D@0 !P`%0;04@etUƩc40`x0t ,wWJtńCY0gp1`T; VI V`LU0C(bs9;p R;B7>(D\)0ad0EN`J, *(0{VP/X9w V&[@Y 7pg!PuD] #zIWЉBp[`4SFpL+p6BPAP7PI568o  @`P;PJ  P%`3 f33"op PPCkFqd:zA\}u0#$?[9pqvwBPA4j;?DdP68B)Z#b4pj7zbl:`-r2jl<c=*\=e0`9UY+!;R@7GP@vq[Ѓ5A1`8mDNOi#3$K@* L]hG@aKb>R+c >P)A0{Qe0 E `h`#@ u#A&T;ѧkT+@n3" HWp{?>[`gcD qwG mP3aW4gPg,H[c  -ǓpQz d(pe8rfm=#'&kl"&$:๵M@?6Pb%0 "+@0P(녇Cc9wY f )2z$91*TvE BH bǒ3Z) @ Mj GL"<`РG0aA (!r&8$1!+X & "0, :*9T@7C$5JJ1آ4bҀ†h tء"XrʡN("Ј3#+/82$ڢ /ڂ 5890B#XbR@b 0*z(BhB%v‹,ڀ+ 2ڀD P |(cTap\" jx8  ؁LF(\,(cE!cǢ0(A+za!DO `)Th8a,@ˆ$hB& a2 !.28Ѐ 0aj0A R؁ "` P("ThC$Xh.5\ +Š1^C>ֈ"P6"hx`j!N40*<*d'|Mܢ3pK7CB $z0"m*z*k+8B)܌Ā`h'Hc7 9CL@ >xlhJg<$4$hn(3U@AdA\l<ވN?A&dHo)8C Z!m"@'0'XAd @Z!p Z 8A FhW^0hPPbp!A҆@P lP,)rڊ֘(, Ӄ" 7 @}ŀ5AScE(00< YKD UE-X!\8+`Ɋ9AGP$(X z`,{.X  Vw21}$ΐ0*N0&\ ch%DJf`< @E6.8 x`Pf HP$&c<@,0x78( PY,( PdB$g`720R@C1I0 6z6D' - HL=A( # 1&eNЃFP$0 C؁z}\JJP0aO[x`C qD("8 35, Xp( ďYX*Pt" m.@!N 쓞QD`@ 2 A n`Y9 ^PK,B DpakP.$n R(pXzC-8ebD! V8 J@3@( @ F>!z?p'!CH)@<z  ``&c$ 1 '@A_#l!GXaB!@ F؁`)6x +#USpV=afݦ03%3!Q= sѤp'P VB`!Ơ#H tP_0P* FP PA5C HpJA 2, .j:@؂0 &A )@\> r9- z86 d X!1 TJJ  @ ~`q+A b0(l -LB16XB`B1$G%-&,0Ё$A ~` (pr`9x%4 eB` $@^bu(bȣץVDJ8n9HVб  O WBaot+w 4'DF#-Ȃ,/U@ Ġt(P0h@! osp`·.p 9; A8APBօ?\C$p x, *8!}1C|*$>AP! DAy%/ ' PV=xfÂ`1ѻdʁ!X-5,X# !ڊ h%sQ<8Cx& S6.qр l!80%')p(Ȃ=a5+ <*#@ p ' H9) +8Fy$pJPp! /@  CX(pi0%H@/ jm, XhB/ȫ#X*H( H *)؂% YM$,P&:R(.iTš*ؿ7:%ˡ#;:@6``=|.  +a"P3+ !3 h2 "Cp58bp P0ي#h%#*(Ѩҁ(b(+2x5(,ضx*H"C:)Y@K2;:4x6y2X.0h5VځȀ陞H (0-`7 83 B % ~Ȑh&+h,$Х*0H&N%( jd+($h(؊L39`7`?@4(`36(.818"Ix (9!P`$H `"0<#( 1裤\)8 %+*%M*$ x"c,2,Ҏ(h$93 @@,x $ 3"8 6@<(@0顀B h*X <$((2 xح?Xp7* '؀"5%ȁ8Hȁ"X,r|FL*T&h!\Z`7.<034],)Ȃ4E2/Ёځ,+'H#1 diO hC@)Ѐ Ѐ ЀT J%i -0&*W񂮄3^}60199 h $L.؀ pvzH`[À  #Еh kxupE RԄ&)C,h*)̂&؈CJ>x'8^Eɂ;-l۔#e$P1(0p$(zɾ.HPŚ8Wې8h;^9S2B" h-(tQ3B B,P+"8?6iXK( V rL E5 ; PQ*!h8 CXP,((E]2 "`$P9P\l2'8a^\x|h%Iҥ;pQb&(]:A/H"y)"p8F(!HUU>*M-b~ $Ⅲ(I:9äUb"tu.A1@ XA-2T\?*`T$/p@Pch0 ,2x x %p H`AH+=X5W%:&.  8TP Ȁx)&hG ΂,#UT+قB0E̫J) ]R-ߢ//@1؂$Ёx`!H +^JIQ*?bU/(M"_`:\j!]0xӅ GW+W+%~((ic8ڂ0?9؂@A(@_1*H,` `\9p !xmp p-u%IP: :*id魩./>c+i(Z3ԑº:j)9fk̝5 8F.0k %2 (#ژ26ȁ̺0f9U+ pN* *K#/opI('^;mG?*5(X؂mJB{2"ʲ?4 J/PHЃExH(/(x5 U 0X,xU@Ph= 98H0`Q,@"l;U, Lw3ڔK"8Lm/l? 4Hi<sh]c%jv30^(x)D0) +$E!+nl6M$XdS*lU@r%~.OQP %T*#ttew9i,/+BӃ1$_ X]@Q H b%x`ㆈ !K Ƞ F`qB pad &d7rqBƊ$-NPt ˟BA䊘3Y,Y$I/bDq )WHRʖ*T ADɒN*i (WlEJ&Vt"G 2hЛ%DR!b J8irHFN3aI(CPR@HY˛?#H8tWȏ&t˴у|PBȻ:4H2cD$2T A ?R +fq FW$k btAzL K԰$ DCYD T0"38X`( |;xPAh`r1JpB 0@RdY} 50($P $|^4a( eg!NDAIoYQQ`!Y`QEAE!EnY]MP! }F>F!rq@ 0GBWJ aF AĨcWaxqkDؐQR! GzEzHC c +p@#R  x\! T FH0z&2H"zֈh0RTQ )B4tqE@%9  BU&q$`D=P7 + <QacpB"`<@)8Y!d]1bQi_Qc'aJkTEy2HlQXWlDlL QC, ,H"%w1C,  ZBAEL()D1 ôC1eaxaGtw"7ot1;B 0B#@%<@, =, Y.aR 0' PDx%@ Pp cHB :*#P2("MFpU %[hT!``Pp0x ;j@A: r02q 0`Tb¤ƀ, oJE** [cKI Ph0iM Lp$a ހ*P,qh@K ХN. ENЗ%\ mԐ,'`OY9Ki'`I V)(N+;p*`:A  b[j%aM(!`@1cv $*< X2@tFxbP8%`',`ADp $` dCZ d i*a^jPlX&Aekְ'2x ^HP-`OPȂ \3pl]h*0T k ( H\@(N0(S iIC ԆDA5  7xü(T,`6Da s}]*q^ 6I# B/|ɋ"e-egm&$DA:Ѐ0ȴ"rPIV^S?dHX}gABn`#a?: Anpa]`= < GXt>X *@ t@`$^`\FR н6 B' D(+B w-_;™ufx l^$Y.!cB }]'MAoH8« [%dagBtp8# `@${T"t:>j1y8 txW2Ԇ(R. M .pA P@7a`2l . L ~@aBB_u"dh^$pX(!RúƠEAV(Axa(p8K,JL@ۄ4@` A T8 !T̋ TE]"=YA8IݙM$dUR#J1RMe (A BPHU"<$P @Q؀ n̅XA @ ԩAAD\y6 En\ e^L) u'~@(D4PJh@" `aAu`K M@A 6XmtDR@DMH)訉% P ([,VfA XA``$ @RI 4@ 8AJEKD| uZ D7ZH xAEU lAmf @Nzpִ_,~'u$up,AHԀ@A ,\`j=@<@ KAV8ATEH @V`j"Au!V fj@X@ @ U %8Adi^ (@ddpl@$ @$B䨚 w0@J$1UT Lܫg(qT"I#(8jf XU\AGAA 4֕A$ObOlaAVttA^侍?I Hb 0dHnj1@ݒkX t$"lsB@ ̗3[\@`a ̀\@ Qć @nA xK d-l\ ܀D TzǛRxd@@% kB @|G!YAXgY)rЋAAh`  :OIylPaFWc#4Epg'd$DDI0@H~!K8~@ e]u kņS @H@ڢLH-c~8Ā_"@ @Gʱ 'TiK] Z01zg03W0pˁU@B PDxA`΋0y7Yr#nE]Hun?t٣s?AL  $Vv$JDd$PDaȐ"G8RE-Y4Q#HKl9 +BXG hnaA*(x"ɐ=x($H9x 5:Nq3h(F=}F/9cʼn5aYɑ#F H3RB\oƌ @~ aBEB1L-kIsɒ*AqK+KF> :Ppᇤ*BDxA7ϟށj&2iYs3gʜaӔ)Tt`:)/k,zj>㿥.B1%2KQ-b.:ܢ ,Ȣ *‹,‹ *B 22"=/`BD0@@ P ~pb%zP/7?A|! <(!x" r#tafa37Ԓ "򲉰bA`XkH8a r`!z0J/xYָV*#@/ \9$ANHƠ (Q8C[sJ젊69v,}6>chv^: , 1a!/H1BX}/jŠ$ s5&h *(C  D b X @aDS-:qSC.QB cFP+`#ǬU{bt !aP4` VIA&@!Dո>8(F `   \  0108A:Ԇ5B`z k8`$: \ `(BA `p8ac[h!4ZE5L>twRH^" S70NFY7`}\t'-Ż9e$Rʦtr Y6 IBh r԰iBG*@6  IZvc'PdXB0&|`@ w5:| K&P XBvP Wh&)1 "- no ` ][~`S"xG`PP@ J0<@+DXU, 8 (gE1E;A䍽C%СkH4<6@.x !!f f[a%>^²q YFְHdV!ѹsBF`'Z|uRgJTAoPq)$ x] @4x.N}ΐa Q`懤0|% RZh5@xÂ|~0] #D( 9L6pYЃ&$aRǘ0M @`JPT` C fMj )EZVxң ` lE.FȀXLbZ4z 8 d;xs܈27qڨM|.CV? C,)`.`… ` ԀN# (n<ʀ` `dcO ,#dkJ@   (|v" tX`:.n@ =D @ ' T k *l X@QlSr`\Rl@ ^ L@rxe& y t.\.d "6&F`)̭&&CΦ@ &CCNB  @FN| <" t @`@l Ȁ F I 8a`Ʈ:@2DBb `O` @| `@j%<A &@`Z\:BVrx@ . d@'Y@`mD T l0)Ę9|C-67/m,h"Y*rds`NrA,991fz;` @ "$ p" %FB B ί I b Mnr*Sd@r! PE < <`R&E\`` RB.%T @` T` Ft  ;I N (B FLR@B l 6"ʘo @CFFWJgKx G wC4']>\L Ŧ8lRl[m+?s ޾AzH& (}\J$zQ~ %UDb @@@JB  `E3 :'5! 8TKH| t @ E @S `X8`Kkj\ Xn`tՄ ` @`\L`"i` C Dx`3@ Nd`"b PdbDT$hVhvm (ɏWJ&V>BPMC: >"?[h "r@TZ%OЎdPvrNdۃd%ʼ`@H{3Q[D W~%4Ɗ ӔW#ehy-zYNl[`lV \Ħ` N̎ nPU`NE \ڣzZ1ڀ~ d@ :T` h@q$@@2&t6vD}  @Z j@B Hr~ CvH@n DRN`N >8`4F.hn!m`Gd$ Zs zcܤE*i#θc67?ܥ]$ym)rOe-;,lRg{AUU| r` %ԠVOnT T\ F3`yZ JZ`@z Z q~h$@d@ @nJY-C`&& Z P@sc\%$K}8F#qP6F = ]>^]&?^yBȆWAv9 K# &ʺ G`% > L0 N@8@:` *2`2 RH@T 05Rd0`$%/=' ~ Ε]HoZNȀCJ` "t &&m HpcހB?JDD$@t Ƚv`)T *Lb% 86P:,/ԊM8%]> }g^c@6 ZX@{ g+n碀%#n ౜nD`K Rh40`* P:B8 jUP~h d:v2 | FST0>$  p`'@ n ʠ_8fZH~DjGd\`p!oj`6WF"Џ /ɹ# Uc'P]jخ#-L@d:ZP{Ȏeg,b cBM J6 I #@ @r. m P@:4Kx IV>*;VZ<t"n`S h 2oJ dX=O(CQ&J`I]H@pgԖ0CL|J.fgcIҕECɓ8F {{' P9|:c~r,Nےw}@ԣ,dZ`m@ @l4 l \2@x0 *@& @ \PX+: ]{n{tm k,Xz̆`%"f%z,w\e 'ᒀ C[ syօc$4P@yQdQ,gLJGBڃ=:BILr})xdvG>zZAm"9ϻ߂i GB $HX 3Ѐ 1B0A hP * 2 5Р< - CVCbQHl1ύ2 Vh2nhVZhZ gdvjƱ(1g\vjidl`HA^(zX!0 .mDf &A .P%DLqDV@U~>!DD1FK`86`%VV *GI`E 9pDVsg@D,GΉjQDH0%` /B3 4 5U %GIܠKGRFhhYhZ *p*Sƛp񚫯.GoKŶwi\vݱ[4&Jxa k+g`qTxdpAl`1Z @@,|n 8a5`FSE_7S@ Ab= lvwDU?考 3gͫ#,8f0A v ^Hʀ%L8{ސ*A Xl  Rp O"  dЗ= n/!3 4AFv&}P1 `.#qibπfLc]6(Nox'9ZeԠ,<6/L,> BGL>vA` %B9x Q@ B  <,8B 0)H! HX I ` fN jЅBU O#gŚ\DXiDP$=`.PP6& V0!m QH҂t ;xA X@N8+\ i㫚6tX rCS32E'ȱ8k( UP ՝8y " .Ct @^Ca-0 QC.$Jp HO( R8hAaCzL9A[$|F1jC"$T ֠JFt×DĀV@, N*" gz(! ,΀ X@ہxI&!le2 Bր OlvfĶ/7+4yˡCpB4P.P (` G0ۅ1@G½MqS85288K8@68u`cG4S!FsgW!Uϐ m^p̀ !qF/,(@8h@ PP>$X" @.XA| + *C.m;Ν3abA) t9e!NJb 9'1D g(mPP8HP$p_XZ, ЍH8PD6JQ*_pGaQ3Ul)#X;)%,%}H"D0(!R֟0j 8'bʱ!ApD"@k$8 RTX`t S `ÀJ"Єo9 I|K8EVm^B"A8Px3\7][!E?0VQ@U`$d6#dG`Q=0CK;>;'Q&"W8J+?00$b^H|7vl$R'1BXMN]dbFC9tMDF/H)!mkA dPP]ULpr0{z"U2*ht b`lQ0M0" dp'C6@$`00@kjD0sMp??"=@0u%39Nu,0@2*b!@s*KPC#2j<aCKK V@z@VUNƖ@TPpP`cP*Qg(L})Jc733Ja[2ǂdutBR/U<hs9F` H,q,)mQ-Po!&@D'@70`@b#Zl }PU'=9!CPa(I&4p_1`QP`^<l;> >8AА},P, +`|AO[D!9 U0^X`pZ6K$LL@xoR qL~VP#>‚ec/,N<КP='}_vAg1?GJeCN[To84e`Y;>&5)-p7K+ؖRvXPY@ LD>`6T2 /Hj7B f5MVxѲVPCY`"AMB0M(]"MPdPx|UNrK`SCp5phvGLb⍃:c%02@R&[I>SHbmcFVx^T9B#,Ӆo$+ds1d7P/44A6 JZ T rp0!@ y[DHS">, gNeh]*"Q?pR'?B6#1%8\i:0L)mСbk 5>0Pk#q](JP/17qDN,0اR>8dr%#5HEpq|28@rQpCIj2][d19Q~vWP!!G8*H35o9Kuaxpa5J /%j0CRH01Rzm* P2+@j6!LQ\SX1hw aȊe=4^@V+M7 -@)`P[ IP@epF<^P;49[DW@7V%SXom""G. XzQBBAP ]iP[0YVт[C0C CK1@>S%;:&Wh2AKHw4Ypq$+&+y94\aɡ@D{iU9d0; Q|7UQ6p_7`09+HahC$Zz^b1аNaOQPXP,͑:|&, XSRa8Iֱ,DL,dUJxG`Gi1ƲH*`YsɉCQU!VN8]+YQ>/:7A@ɿKtfCN!$8OIU>nM`P>Wz 3TmArz x@,[BqV@U\+њqrQ?I++^ 36(Y pe]#2V^f&fBiRS:YeU=P ;2 L8t[:cDv;#*dt^@VHUK)M2,0d'^p狦XoiM< 1(w:#$CP\4%sda66%[OLPeQmm+TɡG(-kk,ydX !yd`Ɂ8 z@/0(!p'`] 3Y3oedDЋ;azhUQUp;d@3?j@];`+OM,8vFdPASMpvVlDVOrXCоzz$-/`qVEc4A&eW`rWl}qA=P톐@&:!IFQBQIQݵ#S2aT8LGўaٖy)mHz+PZ*So'|+%68 7`C5/Qyz ea6$Hb:q?І#+oPق;6-@P ɺBIи,+ɡ!q ,RP1α%6WEi)*cF$:U@TP0G]KA`%̪:KA(<0)>U@k0Y Lu;y?~y30e$a`VrǤ1SXP[$rQXJ% r}NcQ1C}J0egAUpNG01S,HjP-So@na"9rpJ:Rʼ )8* 'T+آ (P"%IB+H ⶰb,H (#@5P/=6"&B3ָ +Xrl ` ^a8C"n+l8xȡ(AH%"X,%[-+/C)7<#b::P6 b &p%" DN@jXa X8J؀!v`&h*PC ,C 0 )C`Ź6I5Bjd聊2Ȩ $ r+x3 B +b ,̚ FXC@:20&B hc?V9"nPJhA(5bXt~ܤb bh%mȁnA &h #(~(C*p* 2 5LŁvL."2 c5qj#քcH0#n0dˆ"+Z!2PA ' OA(^mh$dX (ڻj$0""5/DJBFJ(Ê#"n262HB F:9H/ܠKBʐ4"gXebtXP4a ^< MB` ] T3x ʰ'(F`$(:O"XzpF Ql(PamT`/EPɋD Y6r2X iH hI8`-F ")hA T-?Hd zp H +tXfɂзu%oSgC QKB7 ih춶D VF3A 0-P ڰ?=d)zR bPppcɡ YpCAixh*7hR'p& Hl Jl*B D>Aon)a):!yJx}XC5PEH=(H VRp`#( @`;[~\` A1l!л5BHL>kne@ Y( vD=6 ce h ; Ї7l0p!@ >۲PT*H=jPDQm6 DQ36D.eFc? B!bKaA>dw/A@+@A.2zK`ЇD' N@EK7P"H(.1j@ܖD=)0)ԀLX' `'XA.p@,AĐB@ L ֒F#@G $ Ex_’E)%Y<>!lU f2.m0-!6p 誇.X FhB>;n1^ ELgKup3C3'p։R,XiQA$s.!AՆG2P4cH * pUyhAk#o/=%XtXIG@3 J.ZP:8Aۥx#4 L#4,a+䐅z 9W. ^0WF#h H0P! ?pЄD PT&P6ܢ̳@`Kp J1~LU 1"x`nAA dVa B( f9=yB`Wz`,g8$bq+7K fx[ɟLPA "ph]$F0Bƃ(/2'3JTցд R\`A`A 21 0^@ 1 * `'ؙ#(i;*$q:2P%`咧 9"@*8J @ۂ%!;,H>й?Xȁ0P w3(!`A5 T+W0- -"茵Ydi@-H`mKF_#C GO~C)9ɂ#.ċr8j1,i(&yYy#Ȁ(*058 /$PB5+g@#3A90hk[@8) x+D >F0؉āp e9f+(!)1ȱeYRh@%-85ph ۂE4#ț7ȡ(FxE++# !`%JA4I;{5L5ӴM:DtD( " )k3#Aڐ5/  p_UQH0p(8$"D$9Y/6P)5D8$h<)B؀P H2I('*ĉ"I/9 (μA8Z =P&+5ȩ2 PP@$lY ]B(b$HHBC/6,(4 i.(M(S/P+‚QʋXB8?y3# Y2$$!3`,*x1vȀx@`D9@ _qS)P11d)KHaTE@>XFӴK.pW A8`2<,I:+Pɂb7-) UebM2X5P#  p*Lð951.yR8$M25($X$),y1pG9EU)h24+KA߸Rx๝z 09#Y(!x%pYd!E(XfOS[ʍ.8ύ Ã#*s X   @1'xf K&P (ɳY*p( ] `C)=*7a;"X'" ;R˹AxEg3GU6rӔU[*PêKq=BY4hi5?8*yN=8S8,# , #+'Q$^Jh؁X#@[2@/3.6(Z \7h<x HԵ+0@$xLLa#x(hYަ2Yo2p,-,1(""x"NYH& 47"E@Y5+$"9ӈj^,L59kII2Da߹(eJ] pu%;Em-P'hQ&(q E$-+&X%p9D j)MĬH phEy*`U#hC1g!-B(!А!.,!@F=ȳ"h2p @5HOKB@Fcib6 fW(7p%Clm[%`}X8-K<+ExBh1X( 9@CHH(<ԁ V5Vll-`m闞b0؁&#X(X8b'h" 8ހ&h1H*XApoEH{U<“P0 pM@( R,H[g!4 ! W>S1K/N'!H>H@3f$xs`+iC ^]+$ ]0&6J,pPԐ ⡫9M}s⋄Dx,6;BHAjFh&KT6Ǽ5@B'X{G .b_Y!ExёIGym zMM@Hm` !1L@у4 0#1W ?@,Vyhʩ%h(`s1}~30PLE >EHƨ'< ,whs{Ź /Z:S|iA1 0mQ9>FA,Optዄ3$8!O7Z7J >Ip<s-,$75 S@a9肓[ X"U;@G=X3} s@ #ʒcI*f4K(#Zq($& $2!桨eT b3 *HHx gXA!,4bl"3p'xp}k?'/`"h@:=]m@8=EX7v7`1pv`{@ ,S%6(,)7@IFd&#b1FC%߹Pdӵ s]дB .PȀ`(k )Hj,p.𚱹!a".[S99 ވ4X䁃DQA"(H0Gh fãvGU|0x(-)$BDc 6r ԧC)J(!F!A&J4HϟAZ*HG$#%ғ˙5BTI28tуG?eGOS9oּْć -~)G(V)rL\]f6i6lC*`ڐ2jlSf@Q,3 De@Bƒ P>TnDI \,bLRiFmDYReK,MPS1T@yMDTSe'LQF2i"QBD1j&1h`dC}PeII1AK![4E"UPF:xe(%RHbRIrQ4*2I0rҎ;#4FBBxAP` d'EY6K,AM qf^F]twlTv-V`!g!eI G "F H@*VaG mFki_|VZɱya^tA^y`цbdAmx]m1L*L<jT F 1 DFFUHCLEPqX&1ɎpZH|XAEeHX 4B( )K2#DP$#4ȊL8FIL I"QLL+R[0C =HQ@bXEy$At9Fwݩ&q*H%騒;B#/10CQqȢ48#eFv4Ed2QaVzK!F:I%dikxVeS!tq`l!k.9JY2;GIF89a#!!MBPW,#|H*$C #xHă3^d#=z9QF&Ol0eł"™,a4K.o,ir!Ύ2ϖAk4:ϪV*t+WO(v,ٲϢe2 ;GIF89af """$$$&%&&&&('((((*)****,+,,,,.-....0/00002122224344445656566667878788889:9:9::::;<;<;<<<<=>=>=>>>>?@?@?@@@@ABABABBBBCDCDCDDDDEFEFEFFFFGHGHGHHHHIJIJIJJJJKLKLKLLLLMNMNMNNNNOPOPOPPPPQRQRQRRRRSTSTSTTTTUVUVUVVVVWXWXWXYYY[\[\[\\\\]^]^]^^^^_`_`_````abababbbbcdcdcddddefefeffffghghghhhhijijijjjjklkmmmopopoppppqrqrqrrrrstststtttuvuvvvwxwxwxxxxyzyzyzzzz{|{|{||||}~}~~~!!MBPWؾڥ܀222222222222222222,f H*\ȰÇ#JHŋ3jȱxdHɓ(S\2!2BkI͛8s4̓ Jv JѡaӧPJuo ZMʵWHx8hס̞]˶d?* Mkۻx' Kal c#KV9/r:ϠCc"D{0LHͺk]HHhosܽs #fjI+3{㴫Eh?ʐwe***9Ν p}TO$IU۽M![LS@3lBA hqI3s*\@tҎHE("a4 Q 3߈4(.@!R#bH6*tC>k4?DM&8!NO?\ӂ Q05H'l8I $2BO ? C*)Ґ0NЬn >ވ32Ϥ *eM64 *g#.j؀-a@s '|봼B>eH8htݬC?J'hA&\ 1[5@ҏ6 p,9`3,2-`Բ? &aK~mqaAI%ͤO ʜCH?Ǵ0>K1O(!EqO(C,TLӰ"H@'s>`O(AՎ(sX>cxS%/G:J7<=HU <$]tQ p#5A;}M?nL>dP3C .6L(vP &Z؁D2b|GNv1kD@eQP!y*xE.Ď b_J0) @ ",#퀅m@B` FDcA=BYW4BPD9P~a 0q UG+(p pC(u+BpWD$2c !2̡ =-!ʠ88/QJ<@wI8` 0$Q,G# f0g PDZA cXu)X.@=J `UMnQأEa8D3fa2tXԡ F=ְCbD<0 :C8x 1':a!uZ pB`G!90  #JTE.2A!8Z05Hc8Z^\$1$~"Zh..a u(FQ=Lg|3 Xdn ΀ P 0@ Qf @YP $p\ +Um-x 0@R0cp BP<q: n*8vmH` 0y` h Hh wy @ M p̰B !Q&0n3 H lkp GS;sP` Q@ vyvPpfp@#E 0 |` fBn`# vT ŀɱ TPw` Z2$ @K j u6Z Tп`yP  ڰ t` y ;k@ p? @E tEp`p *0 5 !  0t <@ Ѡ 0 Z P ʰ N 1 0 0 d  p Hq ]  @ WPAJ #a\ p e?P 0?r?90䀻|PPZ`m 0 e`py1 P9G ְ᰹ee`#ܐ faZ3d%{ A)i0P <]/`]b9P c ` ~c 0 SntP p07 xp f0ܰ/` DF\.(2j}'Dp "Pa P` ș { 0 ` 0 e\?+0/E`(P? `' h}p ?P=ppsރ " P ݘ {e @ Ҁ´@ B<ʰ q S0DR Q& 7:P#$ @h0@YTP 0  ݚ  ް? FUktp `$Mkf c@d {@ P ƐJ 2 "`] `&` / 02 `&|PH 0 0B@ cpm_L5 ]0EP` Q  y:\a P@1@O ` { V ` X@{uLQ5:3}Z̋/Ph(/צ&xJ-]\& 6w'=}TPEETҡ6Dտ=1$^s9ZQriD!}z]7JPĎ4Mx2~LE;H\x)P~".i`N`DadTaZj֭]ߜZ8Pk0S Q'i^Et#\f}v%eڿ8洊 2%E>VkX]roG[}Hu*9bcA0|X"%eIf z)sh&flo6`JGi lA ymy@ *_UA9@ aԣ]C Jx9_oP)5J8S<-P|bdh+1y(""6g`<1+cXBvdZ%&PV D hF!\@B?5,=ЏB4x+"38 C Hא+Vn4DQP"P#hrx`!N:  3O?` @*a$ `,4W&0QO6j4 1Aa{q?!E<a'a"=sX5 "c=xẅGC{xaiRı\24C>?pH `M ^Ӿv׻GQ Q<>0bB:^kH0MaF7^ hx*T%1dPB;p]T塄&}ְA B!6 p&X=\!@N\aBw! 4C ?(1i̶ $!%V8E-e" (W`z)TwY "To rw֏2hļ 2̣ \nA>Ўup?щpBN x!XQ}qj(8X|Xuƈ%ҍpLC8`W 'Pz7M* l+R@ U7..!?\WG<`7?~8(+!prE'$!yDB1dщf[VKnx| C^6-xw,H@q (2 px (JńnhȄQxGm:}8Q`~ |Ur>kQrdx{0Aypv.~eM@=P->({@{f {!p*=8Xjy/iH~8 P4 @$*8RȸԖ`tg \XN(u`Ɇfd SHNq[CQ"U OUxxh0h` j()zw87VܩuB`1x*`ȸ XQ028r謓L'0AeP;mH.453Ji(sXDɝ =f0N\LHЄpЃy(lHIHu@=vڇnH1+ h'9X.v0hXqh >Xd8у=Ȇv~40h}p{|Pgp.u8n Eؼ`ugi3!-blD[ȅvJ~gBqdh-R؅h%x p8 c'i@g4pЅiGuyJ*rȳnxmMVЂy…__n08e+}Ij;Fڃe^FSPa+J~{cas(Є|-%!ЇW_pt P pd t=x0I"HWX Pfh-hPH9mIxuQ@k`}U|P} M/qYxL+GOx+zY#m(鄑 |B؇<!0^81ix 2hsת]K]@exx(G3UioO|hMoHQ{m[?u rspqPCv=p7 a2px78$PkkMH] ](FhzOG8v ٲ|{^_PhgoXcpx|P`qaC"}@z؃x2cX_8Qʇ}`%H+H(hP'Hq@v?ie-۵࣠5H2#xXT f͇tpo]HPXqhXv`sȃy8[x|hUjz,HN c0I{p~8Ayȅ2jjiokM Du}bŀ=~8V, B!&@7;y8ʏ@zQȚ(- r=18F }6ʚ.Kn݇CQ|N J%?v`ax{`2I'upSjs8$LgPЇ3r?WѺ80n`B8FPۗUSyh,*l| jx69zpR7SZ~QIBd0c^(!,Y I8ipD [xXspbx&;t=skZt 8>s; u w;0vBTw`] t=bQ'W.5~_(??8igxdkpдiPbKbnNh`,ink";BMaW7@Ss0fz~P8z۵}ȁ|~@whnh,ZwHgjr E0u@2 {ȓGzpu;8/^/p`NiLrvAc`SX{0G`kZP'JŃ/7r#Ȑ"G,i$ʔ*)z.CC]̕54K|>գ/Si}BILe}ss)Ki]>?ECߥkE/A;PE)*Z537>'yR$ H+G.m4ԥQ͸οcǭ'gZsL٦r On4U2oת.,E̾{K$רܺ.vkmޣ$fRNQ;yXO+P 0zys'z!E?O.ЖN4Ԕ+ 6(ЂK=BK9+ٝHup ?{C /(NCF9~05 +tplB5 ^稀AGLS% "J:)?0O* 5f.^zRLoHLAhb;w5&?dOx]㋜O=KP4GW?] kܣ7^66W5bM2C$s?l:=S?<`)(x >h4 $` Qx?70m;|)4LrN7]?]l9=Ӗ꜐CX3OLDtrR[}=٫N,LēRYs< 1+aN,#Z!W?RT`5( OH$pX5ԅrLI}Da+IpJ1B` `D/ <@6d@ zlD%&HB=}CN5vgL&@.z m>^Aba$cp1T8Җd `WG WT.BP1.L P'0Ny TWd39>)xJ0F/+jc>&nbpJ:␋a>a Vlg1[<"HG Le6 $9V<^8haF.Ќ}@ Npb@ DтlD3 0JfEth "q o\cn8bmB^uӈ$AC =/Op7w9)V H,_2B@Dh؎H fAx`XB5F&?D:t5h> +xOC@lBH/̇ k\0BqDP"@&B7AOD3xI HXO:X=>#=d3T .M3R &EBM:B,%a+)P>@?$TClB,h[ 0",#4E= x@6 ؔ/8 l9,?"Eb:$@(-\B¸AC>PSƙ,< (%tuq9b%B?Xx,+|):'1CgA=M TCl0G<hB @78B=h-tA:DB@|D'\.@_U^L.x@&P%TA;\<8¾Pe>|=Ueإ?~W!0C>,~)eB>&,=C4-?eB6MX t.E:A*!H"hV$C@  H@ dCH^n' @:A' ; CgNO$`";*O+9\C;B.`$#C5T#\(J |C70xCl P*`f8PB(.|#́q2@?&D8AD:D*DpJ $A i:!:D:A=8A=Cz܃䃜]8HB)lp!F>8a%}B!ls!9,$=C Üd8BB.t*P4:@+\($CRH\A#]dC.h_>Clu?C:t7tFKC8C:t$#;TI\C5%= 3MA%.H?xUm*LB6' 'B 5,?AP8 HdAr16=DG6TB|U1)<$E5 ! #84>@?$%p@(#(3/B"/s63l;H;y=DU!0BO? ?lWNECÍJæp7(H 4P:;x!h, L)ClKH8 G2H)PA;.x_P37MC*0Cl1G2(9//R W<]7HԥRClA]</V0;,:K6 ;t48DD9Є;4^, \=B>^*PB/x D$HlZHB A$3G`C؂-;t5 8*s$(CtG:<Uv.#KM,hLН5eX; AΉ94N>.(B[f @E| +&8,L7D4<+3z)J@Hh.( *ğl0?1lZ17LFl2jA:B|(S`lD ßL6lD?W6XC9$ 889*%0 T@9CHB,] 9؀<,IuabNl#<B<+\.( C0ğ/Ђ8(>05̗,( C/XxC5A7M>t\8x`$8B A2|.83 @CpfHٶT',!8C%B7D<l\'J$C0`f,B44B?O>hs 28+0~C0C-|=7L$X" E,1 1d5\ΜXC P<<֯aC-L 6A- A'rx ?AB\B<|=A7ߏE,L15Í #3x08\N,l/B||7(7(C @\Vg$!s@BB=C9H2.7/\C&44>P^A>ldB9?B 5"/$ASe1Opt.,xO4`d4A9$t ؀&<`@5,};KL=Ta6 ! *d-0C5|X;?|-AF|7),C_.5 l#t ;,70k1(Ȉ/@7| |FO? 8B;LH.X}$.(ԡt6#,`(4HBd>LA?&K L?=lYTl?&X7}P,J+ (CD0P<:B4~`;-<@<,`6B?A:ẠB(D?xC !P0@ܛ)!nA\~>Ӓn suRo3cٷ>;0Ehۿ%wM?IU ֿQc)k2nb U"T#$c>Jㄹ9Q1ȵ(C\oT$,חpaÇ'VqcǏ!G'ش{z(Ͽoq oMzഫaO96c{h4gOʝӏJ- -_NTɣRb5s/~,ÉČ-oةpkcl儖fENgl!0m*Ó%g?H%+0Aޑ&yU{ʨgIgtfJ^!P7!=ѥR P44ީl&۪lXbNd E0 JCMTE2d\`ZHY#LA]4 }ָ<[ę'qB&b$1e6 ,h';\`VlI9-m|bc !< DsગV$u!2rc̎1X}_ Y!^P%RJKJ]Bه|fqҎȧ =cNZX'3$}aoqņ|V!檬$r&\yItZB0ti0YߵnB@dPzLrɸQz9)ygq_d駋zB';,&WB!CPǞ+9}h)MXnf<"uf "2$djEygy9!ZGddQ_HƎ6mt`ʍ깢P-_b%'EL&X$A~b؆#|"z$I`=+QHfr\A: 2ZC>a"0Ɯ8D%.1pQ…"|<  s+xC?q%<0Рi,ZXY#n7(/0aE?$~\4<(q*#-pO F9 =2D p$mhBGc%帅.H~to D9G!9.XefQ?T~@gh^aDa0h &pP\ pP'B.6CO{p' ؒu=Z *g:FmԣPBhf/1O7x֐=#4)r!Bq?rD W Eģ8 Ra(-h Ԗ c T2ڑ#9 ;pb4! ?jGtSQ2CuR9#͔AE?4->U-PMpY|l+O pC:Au^Qe.J) "H8 )yюCc f@ cΡ(u{ L>>@!+YG5PQ6~QĹA&AՍNcN(=D _ch%:Yl@TYZ00,E eCp`ٸBv~ *P|eǬC7ze`f%֑ \9琑XvTJ#OATLDv/1Z' !TA% a!(< @0 N16 I{b^|6|FT! J>F% ~CWCn(gA>db"!`Fl`!!"6A%H .An#8xơΡ&hr!I $m`A9&xke!h!":!J'#d XT^p:n$a LGVa:+Taar\A,jE> |fB` @O C Z &3=E@ba)I<9:­ƍJSJ(Da f>g a! AѠs`:B!֠!o b|b a!3 } a "0 `K #r:8sI%`Z,c?;SH!fJ~AeI8DhC<^d@!-fhDA! lԁF a8Hj1!IYQD! laxb A!W(aIV!a\RIJ@x@_!r+ ⡕~*! |B axR f @Q#>l`B '!`@ :U%A 4zl2AC2!.!+BE"DΎ&j ag"ͨ6!N@&^nN8!AF|T8xNm\! #`Gܐ,%2 PacbvA a8!N @JLtA/a'YZnva & Ve"bX(aNJv'AHAN!@n}'PQ`<' &`@2b!!n1`FN'Az.AZc#r 6h)$6ҨsA D<v% >Nއ W8!!>kA!"#~ ܮ7:(! '! Aet2DC aeaAn$WSց@!5ET` Nna:;B$+AALa<!: }TjHA9 2!Btxc0A:a dhsDgjAqŁa uCGlJD Df0CA*Tr :c.ZAb Aր@nCcdT@ !&1Hz/aHJ;aAv4repl"nVPa<6':62A)4!`DJ!X=*a@9 Vf$R̡N !dl##`0 !z< `z,jH0T:JQ~|fЩ#3}բơ9HM@3a!gΡ(a#x6b/! H6^j,* 2O Fa z)$cfT ڋ9Yn |AV|BaAAF#%a"Ĩ) c0 64clߚCN& 'a l *&) DAtr82 Z {X`aa"a!#0,%"f &Ա `gAW4tEg Araag;܍ r6 Am$0T!7M ajw~!xZ|ac AA%Jq !d & ġE:a6 !aX"2N&8H!ga8 W& 0Fx`2ԁ$}78! aG#WPo4F!qab$LA$(@įSD~$6c:}@%$LpA!< "a4J J(zIA&3>ܯW`h toǩÌpza~"On aa@iXp!n8xp$^YA b !xa!PKLFAH`AX@z;A !jrE}bd!t>TAo!xiT@A.!rAʟC_6T!l~a! "`i~ 8 pJaY2B <0… :|1ĉ %7_cgGu??A&?Q\'el۷$#p$meFۿBC#p{ (Is4nkl ORg'>P~eG׿KQr׿U$hQ_K.T q]m"L9͜;{8J"83sU줤|ߡl_UU8TZ'#l.Sr`w2BrTJڈZ` |,_-sD #D *`.yEH7Y^a#̐Od4,4G<:+6/2,# ;qMO=?At2Gt#S 4L3+ if >M d3@0'QN<^1?Rv+Kuq#G;\(Rà<Tp~Z;BsɗL3@;%ZK(b@SD'#:lG&a 8:.p ϓ$.ՄMj,H G;@]O ٥.e/;8O(LkLS(I]0mⰤ]fsL,ф |1'tQ>r?PJp\6 *^f ,p:*POq6 r?]9=oǤr?d^F7H:H۴PrY7 ?*Q< x;#1p?rȂ147"ݐx!OS@'ٳ5\@@<`0!rpBV #d0F<`ԀQ1&p'6pr`$aut`0x yLBe*.ZB GWVK1(6*@5(L:}?Tqx`!lРhA#P9=]?찎bi%E Z ~I~(a;;F2 K0 pdy  P*o ok iƁ@!sP p~l0P @9t Kp2c0QMS$g L G2A πS `E < c  p `P٣ ~@  `thU0Ԑ= Ajue0Ƞ0A P i X03 p ֐P8ɧrPPQ - (P G rw g z1  M~! 1 u W àp Ͱ@+ * , '0-P rC Q@@ i: *) }BnpҀ,nFc@+p ' 9fհyPXpd  0`$@ @!  *@8 {[* 0 kpqa* ?0 K bJ;Pb^5ɰ `g ^p |P̰P P° `d .P ?3@Pp@]@ o  A/c e$K  Zp2a Pe*@Pe@!ѐ=p ZGW@{NQ{0p 6 o@Huʰ  P1 Πq 9P3V .4 h0 0 ez $«A?0LrJ*,Z*P, ҴL2 G , t@  2 ֥ 8=PXv%C 6"(P - ``Q2 wW .aG @* !p ‘ H]p1+PǟvװPb]%^yp %& /L G  WpSt '@@ P SH hTs &0W,pY )*2 1 c .s0@!N % 8${, p™s ٳ vp, #P I` p 9c@]f 0@Q0 !01a]α` )y5q0*- 2aNr!M $? !!X kӰ 0ppC r o 0!TbM`  C +#4^WU)`%M2` PO` 3%"3Zؐvp `|HZH. sN=Bpp -נ* @G {Pz@pǚW0K s1ɠ o | bzk`Wp 0\vH HPN9|p , 1v<C;Q6r} 3[ b j+Qx01G PĈD  v K@cp? he@ +g ,P c:~ xep9ۍ.P0 e أcc3 khcA 'p p*a^@ p 0NP YC웢{`Yma* !T&̿Jx*c&ѿC.X?CUda!Qu6؇-K(O!K6_e7MڿNuoξp'1 ?F| *FUX[q'~ 49`-XZ Gy;ebMTgĉ YhljqG{k. CH qdt˚vHCqFâLc*Z\;gr Ǎ}R)cGZ<=ʀY9hr9* dELNY8{:#I0D٣ c~uW^{  (gS lg%z,wQ2IoPjdAq'w'zX'aTf@j*5AeOÔx60l9)pT;k:dNgʰc#L~2}f{'٘FC'jWSkO:`gd|#y Ǐ}A?~67ɤ!'a$ZU&%`19E]ADf8=C%x5BgG'xXǃ+rvu] *d.Q~gkeMgyZŧ{2Iya~gsA#Bɤp߱2BK}Fi'>)gRLVK&HCG9}0Vv1a\deFA9N+]>:u!G,xq]c r,abB? G1r|895zA`\q҈3y6%0n=`1 jB(8E?х}N@?$AuB`-n9\ xt!Q5 PPl[,$e){El qqH!U# $xq+DD AY@C< bc&R>-xClnȄ;"2"zB D*W;0GdD:B!BhF 态@~6#{ Ԩ@MyQΨ x$gTP td !(pE?0pXxG¸ @"qolsE=찏bs80S$Tp*26 0zxDp4{pU:4ؠ pcsCDp&V51 h;s`sG2gw`P"6`9AVfz|O9~>:юuСȄ3 8N@ TsWG<Hn@H=bW Nh@v c 6Hb_# 2k|&"a@$i"rC9p Hp!L{ckxG'f@$C={aD1xK؄{,x0{hK74 #pF'A!; G1X s0oB2^s-1jBI"?fc*SE~)A@8¹C?0hl(֔hcֈLE\-A8bE"hc.,xp(D'$WX*.ԂG0ށ;Y܋ g dCH N?ށLXEZp2?<-\jh`?l\|zP! IC{"\`C()Vi0p!8kQ98CItBk29tE@1frw/J 8(B>!t*rфĂw1È0"(Ԡ/яu!-^fRbEyOPL\zK,TaEl  @2"taP9#ds.>qG܃*vod@Si<xh]{jtܯP(5OC0C?![&?A@P:W6qlGqP>6|#h- #B16!2bHA+@8mlJهMEG0{@TU.@B+ _ c=||0@~Ep4Fȇ\x}|P<CHt-Imɇx{8bxh%hxM02H5X!dp!@hX^NS`OBz҂Q؀#x6ڃX+u8`jAP Ux@wЇ1t ~@ g8~ {ɈRժ< \I Nx`@E:8(0YЏ1 HOLa4OȅmȃSEàhXAS6jʸ0׺~{BI6t=aȆclPM uPBgG^@xh8 >XhTmeXb؀VC(9(SKLU!F-,==HlR@?" r@5VC}8c"(V|=K"Phx{ p+YF k$W]ȓЇq8 I8lȄkri1A"`P4sPX ,RLȇ2CQs8}XAIYNPhUhIx+b}J bxk^pKZB@"2(ꀅ L19gp0ɰX'ihI{`b@cȃ$9n Qbh Q~XxhX2X MNWPs Y~8Py5d`Z8I?J$eI[Xm@X؃묔@piHgp7H(fsB[bH@_YC\v$چ ?yyjXB5h\2=ՇCpy=}GFSڂJ)8]_ M8*hZ]U\Жp Ca聄@8IppePW02wXPaxoih@q|,8" 2{ mhZT8_p} 90YRY(Sc8$6t}@p`We_+B6Jo(~؆Z̃x[+1}0r&\XJ=yaÏ} ܇Kpsȇ+(.(ȁ2̇yʃwX84؆9PyX%l0]xl+ƘwXeP( (yc7]h(z؊NMi@u ~x yv`kxb1px(VJt{hdh/ )@т~_Sbm =ueX2f% u0IbX+>5~h[ t񆦨:r~0bЅʃ>I?~u`vCNHU[~"xp} , qc)ʄoh>{pԘX3Е}PH@+&4k[`ip|Hɇ=ЇyGx{P{ EZٱhyu+̫pr*ȇ~ܠtg(⁈!S.\yr5QY= ;(!0 SxotB@};h)fߌ.tE8-(KFJhv#!^"@Baw xBxXHiPҩyqR8avy~(Z@.pқp!0%݃HsP@-?0kfqO{.; uC c ᲃyprn6P[Fh+dJv"4/h"=1|z8ȇkfRX@-I-Q`yjav9P_%$qr…2 x ʩK(@?b/zy sXd1L]yfSKEPXjW1 X@j{؃|pz*ȃs8+T+`/I8H|XP@sThx}!p 07Z*M h8╧Q=k@5i5:A8pamYhz lXX*W?)I9]H7D=؇58[ ]20t6|HHEp^pP( \[oXw[M(H}"rY!LpO#{ /%y98wc(TwlVyF}(t Y0 W>gx‡9zЅɇ H920V+kxTbre3(Mȁx(l0]p0[802(n81@-WX Vp0D7Hf-oD37Fh+6Cwh@0!G2Y!C G[O)7g9Ziœ-ϿL5̃]`fɽVbͪukfz !+ٲfϢMv-۶n"k`̎Q VOykR~?F?h=Gߘ~{ahO=?8JtRX ?W䃏1/8CCHsQD!-ߘ# v\?WU dc?pI/R?8"(\O-8pr c{['D7kz`MLt@B< ٘O9I?0]3Ec@hPHhO2}C8-آ'Ea{D?T, GHcL/5Z>?t3=H:T B>?aCbnJL碛.Q?@D=''<9"&`ɠecSH:F [ac#ШR %͈s3͑-RO.Q CsXDYJH`SIH}O3B(#8٨D1N1C#Ƃv,h? \ |@Y8>e݃Ɇ90FDP3x ?+$ "\/J<50 7l 30 aP4N0zPTJ2T iF.VtH#q?Ɔ>Q Dɨa氇mJ׏Bv"C?q+fE:*$ x*L] <%21WֱFc pD5+BȌ )a( pc `Q'\ fxG#5\*G!oܢD> Ђ@]b8V#q ? DN2DU <05\ jq4@a$z#[:яFC<:.E216tBU.c ;'A!r\X4&~B?@2p1`a|¿t@?4h""Px⍮~ 8BU(:yU` CqsC at,!)h̓|5PgN8`L;܈ ^t*D1,Bi P1HD:CTE/*A@p'B.ԃ\>,=A !1L2l>PB9H̃,D7H)9C-0C?B/1,A @ A.-(-SQ14> &>- g%D =D !?'C=(C!t$?(l0|GQ?\ A1(G(l C><C7؁2t!B,A B?.T=@bM,$(9C&xtOU0zP*ă C34\%`/$QFD_̄B?PA?,U 9C7 0 mq-!:A<2@(%[Q\K0@\ -Y0\$"ăGB*ImTBb?PPBA-A=@BCN(CPB7E;<!/}\a~@lwZ -*:6( /Bp#A8(D5< `!$DA!,@mZF7hA?:R3"T&+G4GB&%T: 8Hm+[*H|BV3(#åP l0@ .@'B0cY9TAq]&C ' D vM?`n+1`#Cg!tR]tBpBq *?x.D%$C:d- @!'E6@<T$C 0.tB=t,A`X` H"P/x+ C2\B«(xwx͖^u<|ѵ%$B.6?MB_CEkCXf:By'<#BḂ.|s-B?Am«F΁C %CB Ws|A1Pxj!|90 :_ ,0 =T6-,"~mBf:l?LԆ $9T+7D:L5l.>mʖi\h<샎E*2T2B#Xt)ClN# !@(o9@oZ2܃_PCۭC]D+3+C&/<+ )[AԀ#K> DA@HT+h?0c5.B<8>A=$Chޠ\8B=`5:CJV'@C7D?6}08< D7 C%$>,A*' 0B9PmDŽBy~Exd<d?B7-\B:8cBɘ8 C$BNHhA7B6x B'TA._BD<$,,Byl@,T: AJɃXCN7IfQfHIlcC)”e g78qgm@#UIe%S.H a*T`ofpd7 Yǚ2qʼneIy(#8gs dh 'SYBd|!M?èeÚL""Csvgh pS;$F(v 0S gId0QdTJP!HTa #ѰH.ULJ {8c#Ʊ< ',u{pJkT` 1F9M88XPAո^ 3(B1L.,?A,{)7 b`$#th(6 C3rDШ`QLPp1` J x+( ]CF B x@X`Lv@'RG1@QnaVҏJ_H'qW, !䑇IHešh?ZΚuTP`k)*EU'hC" MءC2z F@p!n68q :g8@:FQ]&d =&v)}AP0! qEaD7 .I#q(=xkڡ l@03H\a|FpL7ZG j́PDK! [9N@ D.(߀>\.0bq+DщCW ,#)Bp<>#E U% Ehq@C=~!Inl"۠(aEG0ى;_ 8ce08xm'<yG B@jA6Pe {2?Ty XNKYD"Q}H82 vtμ)f|BnZ^hq6=c*/v,Q\B@F X򐗛$(: hC ] =Q)HqZ C(0[A)&N̠V{)! P!ِF  @9p d#-R A"CotbxrT  N h<(e&(pbXk> cE$a~ b qco=D>3! Ѐ&l ʡ a  YMV|!2`Ta| Z` dAHNArP=&J*<\zTAl Aaj2*vdN6iA a Ha *( avh%a a :d! lA]@a @"6a !ҡBA` @~ Ov8в41@~0!kGڡ@aBCPaqpA\a̐a¡T@RVb 4apaA B6! B ~R[ a^\a` @ x , vLB@,%QGLl] Âb!a؀aFja&atD1rHaﴠtVT nAX.xD !| a20`!jA@aH!~ `vZ~>HN>BG$4 A-0! ``)bp!!"a@* v$ A!A > 6 ` B!<` @@ r1"*TcB P&@xfN#jer@mf`G@;@.P)$B`Ya\afa ~n)s!ZRH@A58!Aa!s\*1leB& ~n ~A!`!i!G<AA&F@HH)`@zPU3dA`*3LN r@!8!,A-BJ2K42a&aaALaZ !PON@ c 6*VB$`$"d`x`hBVZL`Ga!:&u _˶2 :N!a NAa r7<3jfЀA:F! AjaB v0T9H@l ` 6!%*Ba G$*kgf`O& @*@!6 05H)H f l16:f =D @S>AxDb"'M!!iBb x T!HaWa0f@tya6Q!g%aRw`y@Ay(fH g `@ ZGBJi!XR{x0Zc `,AApZvTPX6.WIN!h&ࠐ f&Z`atI7>09•nKN! @@B! "ր<`< ky%B`qaHaA0@`B֨u \%& f`ᚓafkm@1`o͖7"@^ʀ .a&b~bځnfD8X!Sa&B Bw "taap WV"~Aatya aa g ~alK'B `0`ʙGZ2BsZcʀWVaEF|!|! ab x !!Ћ! &d%! aUBk ~@ v/( b!*!Á`  F`e4m`L**<@B0m@g"<4e8?P!;L!: "aAx# l/xh+ ! `a mDA>*0 PAD7 3 ALr"R wL F!r\xlPJB!iE D gʀ!șp%XA F` A&0!a ` ljhD  GlI(`.` t άZ !AvbD"ԡa2!2 d $  :*8 ܀lal@ Zuar C&,r pAg<6Z`aD:5`Z$épC(=(!8a:AB`R&a &tIRy@`N Ʉ hF0~tLjA  &T`O<@H(Tp|`*T@ X!F&$w!tAq%x A##Da4A/\aGx= rI6 (z%!MA V9Ա!PE ߿3b4a‰s,jIdFh*xɗ0cʜI͛8gj@kI06N$Q&d8]^vM[o5JGLRy9{/צ3퐾phFk<wb4pd1^5@5f<*oز`ʆ*gCـx2@CBO9a֛A.D1%D 5 3!0(픁8=J$iO9D?8!D-< DH`QLT `pdi7)0H3c2 D67O=nS92|F?` 30rI6P<2:6pE;K/SLnHE,B0,N2d#? Zϙx *4heރD(9\CE(+2A?l%Tr>Z1*Ǥ,)rO'7;Hܳ $P # ! 8@>2 ޤ I=>33eTX18$S p9 ITPF@M&"LS?K6{!\!⸡1$71+"۰:N;G9@R&0M7}G?ccqː k$C?!xr' cC ؃ !HLFv{=BsO` W=`P4# I~ hA v)3`&0$] 1 *Bq9tP GtCRX*<$wBF 1dg G [ @C8 G`Jh(ʰlE T``P>рT0bX m p?шc +e#_Aj0xH`DrdqE0 \wkN @,g&RP8 3lxgc XB>fx@3ҁ~:cE jTc Ђ$Ax`N@6 NM%vTbxG3cA3QF A 7HF"@ ;lQ^h,G0MgP{ yHu3:f$`: xqW5vt8#RKHˌD4S#-F02`|Z$Ɓ$*~< 8qJP>рMG.Tjc#~ I#HE>P8p  H5HŠ  X~|c3*`TRݙTH f},aG=αi7ЏmC7*9x9Џ@DC?awH";"ƁW$ A+&B"#h?]L@@ZZ8D y`b*B i =y6 0K@x hA)'~b d<&PAV쮚לzb3Ɗ#h2fc#q ?@H6(nȂ(p i"xkp#hC a$\q q,MZcE%s t3E?a  >Th pP1 D]H D p[';IKB^%6ݽ. ,JH*d AJkE;tAO|Cc'h$`A iya;AfD0F s2فmb0Pp?+7:2+Ă+.b8Bޱ;`_@cCr .N?> c8{^:L `sx.cXI&4P @* -a;B"(lpdk(" U#ȇ|DLaGA(B>!ru}K21C! `$p p],Z| ARp6#@H`B$0 Tpc` ݀$ {8  @px cK(<0 $ 3pQv/B90G0 6' *e s  y DW0Q "9@s-pL@Z`*$p*1 e &̥ p0Pm6+ 9jw@?@ Y#bpA 7 v0Pp ݄3@ ( !Xt@  PO-y {@!pN@5 0 *0!KP0p P 0f*3p ]@ Pp!  ׆p c'q?%F @Z@NP~ 0 t@W4 Wɶؠ Q09qh0`!pؔGЀ` sPk`$X 0&P!@0JPN9`m  {*QPB ] e c  Ep  P'b$0 :B+ vT>$0&7a`a~1z ְP0n NT!P )p@'Z{0 P p6 0##!pYy3E-ݰ`&X&a;.1F$ g'l82XabP(] oT@ W$\sɗ !ց# ȁ?#"&+ X<78#A~P rB;`!#ynXb(b G@⧙gF)É \S3_69DmŃ܀Hd~!v1%8 $Am>7OYǘT=rgz)#+ $ANa&h,avf & TUH` 7&C ¡"؀4h.#`"N QtҩsY'hR! &Xl 7Z&^j u`lpbω"X8n秿r{iHadF 6PPK(#p! BB' AHp@X@ ~(K`j'`A0 T Zvi~-Bȑ~E,*0^X NkcP 0PX 9@5! EэG9DAxDNf~Hd!. qX`8KC-JKА_!HA:б9`A!vc<$ J ^P"@$8u#7'* <b p+s"Y6Fr\/v[$!A ls#T:D W*x*`- 18#B`@C*L!A&x;KX T@[AgPpF8q-PݤT!XF4|"Q=° 8"BVMӫ_u[?*thЄ.a ȁxZ@$!, A6 &H@9pF@m5 E B@PXByV(bhMU[g+܁H=8npL"jh0M۸FFΈC{%&$`E&21Lkxŋ(` 2EAr2L &H0` Da`AÜ0`h [?Ь䒔Tr`C*cp+`1  8Ah9H\ 03yeDpB;a $Z3h8&G3"A(@ fx8Brؠe9@\1^:a:AF%8,+oo,@)"%-&{%PL_xd{uU8ȃ-pQp408p6S/Ω =(0ހ$(0(Gz ZB%ezj)[XNc|H`7!0J`\X 0p Hx`]r@Gh=QHPVІӨe [.TJqN0Y3 h~؃P U W<DVHz{|ȇyHwxqt٪{l.SЄ[hrvxvpayvpO';JpCNvp{uXdY_hi0}o8`fa't%07KH06 :HEpZ(Clha5+ Adȣ(؃c4BRK^X-TmAE,^)JFGk|Xn@qSf€BZ( 30 J!qPPpIꠈ~N?X$!(2ԡQ)IPE`\-qH@ortVlI)  ȃ%-S*PNX@FAUhp\*x`&8N $p0ЩxM(x4TO@AA21mx1 )%hd8pvs@([dyp\ЅМ l\P.0zN08Apdn(X(%1oQWPYZxig(T?Ђq9p#m1|S>PZ8sx^t@m8a]sA(-ዱ&4#+ (7A$,x:S{h)XPhp)c͙z[u"JpEXqO ęXNx&!*Ȇj<ӂS,)wH 4Kr؇] h%-x؇Iq (m؅;B9 ,p݋0iMA)2XNWA@-Ђ5X>_H&]AըLjJ( |QiBx_5'#*؃XdFG4ȁ1 PpudQ KCqLUBpv HwPS;]}~`P4P(H8F!脄xPv\?X|fe?ȇ1$6YiQ_ f|.9%!(賜Ā$@%@؀#g$p8u',2(BPjux47~Ȅ=8S4y8dЃPHk%Ey){` h5ZymhP5ۧ j.$հˁD7<Mgm^XZhexhll؆iP@Pӻ5J``po0hYi͆[2Vu_IXkyhtHuЋȇspftdpЇKvȁX8ФN(l('x SQir݅ :w(n sI F#O<똃 6pS)ePM9\ )aC|sz(*MCS>Ts' 01 4-81zD(XC=N2r)T9ÏM\%N1Иh= E2s4xNg缓"-Pe0o" h\0Œr4Ԏ4p`3 !mC%4 ߮gU38d3O>~.25#2[~̲e"(k1FeB ߜ5 IgݠC'!bS;tPQjQQL'm^ vL/R -\;t? jSQCc6YG9lrvTop'M*Z>{c``&x cATp$!E;+(֙|T#HB t XB!a 0KFwXT`TbHp( k CJch,A=a B ?BmG21{Tq f;Y '5BA#:e$C6Qk-58hMF$0\aG4>4 Q@ ; E.[liE^&F,P=۸>~3P M@7 a0z\gDD!%0pBl@ Bx^"P`O(0( c  I/Aܠ; 6-qjDk`"vC%@A UbU^› P$`! \06pN\BD(<P-\C@9A qD+\aZ°\`/X=TF)/B{<XG:ց:DAzXl :=vGMAzxc/ы\E2f ‡ӏqAx@[bF2 Xw8xck/01 ]9E6 sveF9`h&t $A @BPa`C5C.B,DB 84sX 6̠ +`A ́G`|(lbALA!"*t E5r.C9=6Ԃ)8* {0BgxI0C2B&ܔM5C=@HdC-B(\X5=:܃=C6C*d%&0@2t"`@0 $A\A0B-H?6P*B&A(B/PC9dRm5D4dB'<P_]#l`V1<)tFJ`3A$',,&0~&|)B3\>C#,V؀aB0hC6B%Ѕ Q  MX$A`A&P#B&89hdA8m*@!gl0!(p&0//-B2,4 U<30C8̀"t),!;B(T/ eYW5νÑc;4H(H>:QCI/+ `XL@B&+pB7;pC=C<( X˝ zLǶA* 6P"%d D*x&=@DTC>8AA< ؂Lv|27L>2B+hB(h.yC7%<4l%p0$` S?hB`;C5 "-2-Ǯq@,A?CH:<"v=E Y2PT00ChC9X-9eC- .!T$H*)4`<E81r0R>C/`20TC=7 ik" (=9hAM> dC0.l1!\=0/4- h@$-1D*'6@lG-08,P8ȃ::'WD<@.B,tX>l 3#쁰EHD/q 8&5@D>&JaBtByUV4n5t&(D@$.8C>9*dB\ L@T,@M]<> /B1 C6C:|C5D0-&d#,&!J mC+x !^);̀hB6ÎJM 8G9؀ XqԃPR.> +,F]ح [(./PC7qP<:pC2" P"t*243T4<30'4B h"H V! D)1x,M8 *c5T:+Üp6x?'D*3@V?B8l=" D!3ǑuYe̓S>1%hpH`́" #>#AEk@B'  4 ysI 4,Chk 0B$r/2`8|CsHK7(Cu(\c̓<5lC<Â(tP-(T#HHpK?y`5¥_&Cy\r4\'\(*$5DC-s%LAyhଡ̦FZ#D+|=G\I1[;C9HC0(P(5_>5>M<|-xBd$B >C.@ 1d[;=7D-hh'7h33l&P4#ʃC$N?W{0#\"-/.֗ͫ{L>@lkFKM(?!F8bE1fԸcG~9dI'3seK/aƔ9fMi[rfO?:d{]KEL:jUW;1].1Fj[oƍht޹c(m:429&DȐՖ ]G^a^A$c[)kx6袊2$b9y'uRW&} ԅ2ƘWDPEmi?lƖO( !Xh! ViGu]^G`gre2a`#`Gu詧? oC՘0",*p6By|8$-`Y<`3*GA4Ԙa}ԣhH ~% `F81qwcPG8vPF/!Xp"BE Hz0`>LcatGNuQՔ *Ž}$> TA` ?.8aG1>- J<':2na/<, ;XIUxE! >>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H qÇ#JHŋ hǏ C1$S\ɒ pZʜI/ɳO]bϣH S`l(J&DRWwBpc6_Ӫ(f݄j"L𰣄 H ‘`$g0@#>L#X@ Ψvy2x`&pa@'9M|-&xPɕ-CpS9|@ @2I6[߼œ6p0f 7LR H`BBDCK@):ֆ#p0ZO \$B$Cf( B Q@01iBLa=(1h @`=QC @7TH,lv͑ &Yi`a.DPH/%k9@CLD,P]qAd8\ GZ1,`zRP( &DH[܀~ `Un=Q hEUlD-p mq5jW h`:`Pcp@l@(PI.KU .EI;MuRB 0Ɓa` 581 w@ZqQ d,`I}$XqU?!e(X:(JVFE)Dx 5K!9 i v  oP܁tR7pBgp`0 {Y^I^6RF.\/[QCO\XT1FP ̑Gd POW`Z=Pq%<E7G<:|s@~; m,QVnv 30 ;0DSpa1<O( & hp 3_Mp @ G -C :`t` 5`< Gv @g @XP@p 0XA`@! MА7 Ё o5!4@a 0P8p/!bЂA Fp'|%h 60 Q&> `~0hp 0` >LE< 0$r&0`Ab_Ї6K C"<Q`${VP\%y6a0 vh: \@p3Ȇ Up2f(P tS%Pxs g09P 8E, (A̠+@L !X/MFp5NC8G'pb9€+$2: P"pp/d 'K?GpAF'" t͠?hA [(}%l \!< }{3m (pe,aXD` l |5h`C`Є0aȡlBla 5B wAda0=k?X\v}; `4)SSq\ CJ=,tN+6F'~+@~@}NXgp9Pd8^ vKR8: 0p#D~jp2! rTܔX5Ui)6SH=yT0Spp2AhqT0m'e 08ONgvMLpHX 25Հ54@Z!o@#9b0iNZ@UVU`Zip{@ە~Hvq;pC?`[Su@$P+F0vPF{BuUYrZ6K`2|Ypgy&l@'4e{@(*-@M+@({CӒ/iu2Qj!y|N[jvO$[2Iy-0=`T'}1X8]vSY`>LjP7mpR5@sdY6D ?sC@RD%}IU0z)Pa_pwS; dP"[c@[p#Xa`TS``%HOpmnN9fbptopHP܄k>;^5dvp2'%['{MgJ 2$: 34PR (=-k%rP[gه =DŽ(paA 3-@H:0Zq@%`scq *3XS)]0_;a1z칡—'q 202d6twR8 yH\tcYNt`Gn@vS R0p='2<0X@~)9148(wfgpBpNL:Rd 90kЦ7@EaʘP`< 6QARB0(|y(ђlVheGE2 gpJs00`~P~vX@Zh+a*4[ goЈWXçPOG6>v%f~u5QSpaa P@ 8Opi=qv_`Hf`7N0@Ga6*fp ;0.:DzkNYpy0P|-yI*@oWuc}7:`,:\}hp`ei]pJcp\CxNs0LYVL0p PPSE0[ %u@0][R`t? a(N Y([uJ0|CSV˷<iO>@VS09>6+ఔ Gó b( N`X1vHº1n@bؒ+ziwaA|wc#wo^-[S@$䇳yt2QLb`%@@VЅ+ ¹%XN`UfDP?ygd80BIw|"IY 0<ܻ32*C3mgf%hz0NL]зz.c3C:P7`M**M0fr`fm𱒗5k-qj`ZwN8eG,P/ A5zKvO ipGӚ2o L)yT!Tp1pA^PtppSipO~ y;y~TU޸gD f[aV3]>RDoEe\sf+)cp*@=f~ Mbc2Gsow(bZ0C6.4cl_gmv/]~upbx+@e D'L_>QD-^Ō'OzH'azj(F/)0Uc 1 RO%O4+)ƈV]z%Ǒ#ut1,]RǑ'da$.U`Ȩ2Eh((E)JHՊX!|ŜYsװY  ^0\pK 190a ^0~RȓNĂfխ  0 u(yr3D-SI*?8Ic̕-f!1c"*&A$0­0B :b v¥0rxB)@ 'a  @r"@'h# #% $D2Ia>ÉJb$7>AһI0Ɛx# /(h;P2$XIt, )|". A 18!0xЁM74 COY!38,$H z,b @א`0LM,"  a Ȥ ~uVw5c56TB0,+V+LxV$XQ JNPa9v#;*ʃ*~dP'-&2#) F b ՄM5Lz+<2X0Fg012 6p"/?XC$JِiX#d:H:#ܨpκ3@!#p-"X >tc j&[B ⃈#[!o!P⌾ .p!C.4x /F @#$3ȨXB2>Rΰ8Dc.FX@k27 " +/?`P"6d u$;  QP )$u"O!' VC30B=#d! bf=0p e@:}P_dEWW!a  g\Rk>=5! 0 al Ƞ4Z\qB>mm#Baĝ"drkB2 F @q Cpа$L J#HVhO$ ӡrV\|! "H0C i|rNR9@M@H瀟3'P502»5 Kȣ~QAO ȴ3 MA ܴ}+S{))$N8Bri7 Lp 9 l]%| fPt7qCރ((O$+Ra»auy%|H C]a0jKBO H!Wxer9hȨ ""xP (5`"8% 0%`){>/%(-)(Ӓ@ xsB0))Ax+(`2:` 6@-AћXBЂ!q18c `8#*590-hp6 '+54PC 1C͘@'pC24 x'*A$ȭ '0xH+'x!(!u8=8*BF J(|øhJE܊=> x"Ђb8<@51gJ(?@4p' 5&: `Z7x%.@8ߨ"p5T4 :j3X9`Ĉ M&Е0 (/qp5؂G/+H7@+"BhϋM!-p9'-H+ȃ-.@(@>-$Ё7%P5h-P1pNc̐PMOF6 Q,+( +3P/[ p4h+#Ji;4,; P҉1:H7';K0 ̙0@1*NhHh-?J@oPT=HTXT1? #Rb;]QD%Ё")`"9h (!Ȧ' `? J85È &"X˽?X,ۚ` -*(<  ؁/. H)8'> yu X⍟/883XܐVdy/܀0/?+A%Ђ5b, &@_݁:H6*4(8%>8"ЃXش""$X`8+P<0*$V A ؁aݬp H Sx1 C(?1x H(6mL c3 (525(`dxh8з' &0$w؀܉ #P >DqӃ.?]k; -`i16 +%y=I)xP [* rKT5XȸЀ> -($98 pmK\LrH3/x$  >f҂p`4# P~ͰH ^} O x^0p3:"؋]Ǘ[`& >!(؛8:(-.4 ˤ4H=hjb(> (mq:<<3@nj/(E03 4Z0&L-%x#")`J!Qӊ9P&9@!2$-#M%6#1hΊf=k" ? 0 !-uPXnpuX 4x8 9&&3P-؂ ` z4x%-0(Plpvh.xUpЀ3# P]4ȁHw,z7/GD==1`!&2t4 ̦ؕ_H ? IwWb]؁*gI0+X؃`6؂h@&`hXע-;K;h0ؾ ؃Bڹf4`jG0ȹ'Et&Ӡ"p !&?)f8O$|}Ղ`@؂u" ,O hi'Ȑup0肽q>(~y+,h „ 2l\(24AC,hhREƓ*C!fE2gҤpC0;~\!GC(1 (HRLFOMr+B &0 +`taK&@BM'y LPtBΟ:nf`B&1g<ĝk,"5l 4(SN0pA0|Q\0R>4@ 2!3jp0P0l3{2̴@ H_Bi4:dBw9DF@S+2i0#S!<C`Ѓa|@P<-41Q(qDU>t(`#%CD ?|r5Ѫ!X &@P*<G @!W$jEoQzx̱KT 0ƥ0;` ~`A W^8q&ȤC^@t04@/za@oBn0ATiANWi@|" P pAZ\! 0ZDoXl,Z8&Y@|p@z@ ZAZf7^@.X @ Ti%X2P'xv:AbPm8|xx(ʁ!AABX4) e2 `<@e|pQ{ZP, B E`P@)HDtjjxJ /3D&@.pU AZ/(Whx&>xRQ5'<3-4~4q`0; bHe0 ¬@=A*@5Ɵ`: g@0: IVD-8e 3L3 4]c F%4* 60 8s.e|)~! H[z@ t9'P8p4pF(A _(@d- %"40 v0 dx Z < G^ p Q>6A Z#rR B/u6gaE298i❠[ˀ^ %t @@0p cԀ5?n0:AZ\ B)a C b=@CLT`>~>x R7@BzW?$ƥBXa\A# YyAw`^(”cj2J"a?İ2a2l /@_`2I $`'DF@d д0A 7 ½?pHd$.qOivJIk ,AsP @0e0?t3B>Dz%D^yVxʂl)P _x t( @X} }XCku ` QPB 8Q7? J|j pqOM.8 ? !P%0o\΀; \0Wt‚Є @PB0o!Ԁ/ B(?ANC[6 _P7P=yj@ه(@B`CDA|l h  āq̹$@ <A,At4JV`V\DFWAq>}eD][A(ZSЄ`" zDN ݌X @ Z@ 𕏡<@x\XA AӨ,}~QT&~A1N8b@̈$ TL^ԀA1$%^XE8CYypA0ӼSuQAQI@}\nhAl1EHpZ d @)A 0-Ad@~@ }AHsb9:J ,nA@w8Aб! :H@,Nk@W D @ p Ife5mDPh#qjeSq 0A@`%W4A2EADA^^Ke5h ̎L\U ԀD@@  $d (|Ah*c+W8 *vvQ܀ xNK @`EW,R 19\% `LAA4,AqTI0`A |R@؏#Ay|O5́8x%H%I8cAp}Ax!4H8 L7HcAA`"}Q`x@G8uj\Uh5 @A|M(&A\ 0hBx  A,^r_TFkAW쁴؀ƛ% gzmkAMADPhI N *~Eڨh*9 T*HaU0|>J*rE M%Jl**"ȟAj* l >ځ0Bmb gamFb!Ё غiں"*@Kܺ)Ղ ilߒ*kA.ZO@;GIF89a  """$$$&&&(((***,,,...000222444666888:::<<<>>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H*\ȰÇ#JHŋ`ȱǏˀIɓ(S\焜0cLx̛8sܙ 5< HgУH*3ҧPJJ*UjʵW- Jٳhe(۷pܻx}@ \RG8+^ #Kdʘ3k ϠCMӨS4@װ-ͻkݾ ȓ+VУu سg Ͼ}/&|q Bl&* ,`gX5GoDs ,qTBuLGAƃ(G(P@EAfDP>&AĐ(`H2-AGA%@ lHwLA.pAuhY0KPXtpAAX`F*Hful TTZFVvvz[W\1Bhj 1$fCBpR IC:h(20ƫ4@4,ƸsTnE"mN0 @@A+!E[aFdUܠGc[}1/SP_r8|d1Gl3Z|B԰^AcUc8dzhLgYJvP@KcWLpRQQ .@k='9aFeTᰁDf`kY]PnzTF ^z@L W\T=`H>x| PauV@ Y -D ݡn>=p p*0cك`}6t  FH p gX pLi2Cu! I`=pAЇ&u\#l:z@`4p@fzX uHeHǏf@J i<8  6 "X \؀Q Bx`uLE1`4pT 9XPN_`dBI C&ƽ{CB dAbP6+)hpL  b D@p -"Ppn`m"( Іa D % B9СC=?}ހ )C@AXp2"M|2=҅ [P2!z$ k*!CPQKgC )aA@*U9WLjXe 8 |@0@`TJPՑ*IpmTI Lp?eGrAD$s@u  p=$ @'p;d%;Hn!pHPzJ\xP@d XCϊA!uC^+ x`!M ˺ Ufd BZ'H XB0 '~QĆ!N:. .xƸ/tH/'>X06!wp1C AS0@dAX C!R$ž)@!s8WHR2!Z$HY 02GQJP!Xp{  gtS&$H Q1kUpC <C 0d~%~d B80 vޏ = |l#8{ M7i^6D IpuA Ѐl pD2Ɂ\:v ox z!3R#&K? X oa8YE>"#*AvP Sd ':5C@k>@<#|u@p 8J ދ$p(f 2XCn$3tF"ohlܥsd[CF[H` X@P KhppDS !C01}rs@@@Rl9x@1^B:"oH<X8D>0Pva!@vCP!d=P fPyQyp[F~`O'H%T`xeT}  /Jn !J``|'\ xPXY|zzyWQXEr026N~muQ`ÅKYeՁqB0&AN@Ghz,}|\ aB `05haQ(PW& |؅88, 1@̶#Sh '& )+P](hLL FU}9p]Ȩ|@} q%lphp DSZHXBP}`[1@[ T !p[B4J@Up4[PWX@|V @"~)|`2P028O0Q0|W*[j'P630k 4Ik@*(𓢡 N{#$ p-r/xiv @`PRDxρw;/Ry0nU1PRUF`v#&L@4` !`-i07Q04Ѓ1WnJ`-^(9w@WKCLea apW 1S&'r(} ypp6p@| aq)9[&S 5e(oTZ@qEP`hp!_ P j9u@] 0M[0Mk1Qfr1#4O@9iP BPn|?@dc1i{ Qvv#ao*N0Eri 0NR@sHjE^mZ1d ay/t@l; /RseV7pgpa5PypM#z4 &B)r.1JAg.`X 0.9`CQ\)Yԡ &A|*Tr\"@X 5_0dSQp%\0įqZX04C3-R$p^rP}lgh`#[!m%':$!#'M` S$d6C*009r£|۷E(J! -VK~ G`A2@X|KiA`a#A*MP>rHEP,l4I/!v/w c1`a80B GГr P%+I (+4-I&,`(`apr[ d0Кp1p 68{xM0p`D* jR`F"4/dH`Mp*/2{=*?@GBqL(:6TPoY`)TAE &'0(+tf^'l'dd +d"7)Q`K(JE?`10pgOJYf å2h$088qP~pS}U@`9 UO@1#)bPbB8pf:@ >iY!E1MT@b#Wnm)08 DQfRZ~xМs F9:H^9PT 46H@,LR;Te(AOma`U9f/"qL @ m d`aTuIKw! mq@21q0uq^@`'F j; >rBo\%pL>< &A8%~@ p[k0P5@JSDa/BpjBI|Yl.2~ G}P@(63fu2p!G@"emq~Hf^D0=``f&@$67le9@ Q @UPo]>0`ͭ1s*ZA@`p/PB' )0ޑYp (#g P'A=$R \A`@+@u0/@7>p0<09QUx:z za%$GY -d90.וl^"H{<@;P eK20NL~,0UMM`\gSO0 .u`E$=Ypw^70Pvk)pgV'萞qp~]@H0EP !0}J1%GHK;r@NQ`h !,F`Gq2*H @mq3Z]2``A\P`4kl `p6A2i`kpIz4]05_a?d`UcfAU +agRA_00a Ϭ?PZz9 <pq'Pvy>  Sp~@@Q/%qh 8;p:02I/xkP.R0 QæxnllP30D4B#AP}5(PUnky0y@7<p0`"6=fc]#ǎ$Pq]_ &` \AOgX1  p:p!!(; "#?rP93 9 Y1J{LTp#ǖ 9PCEQ@%KEeIM>UTU^ŚUVG,%Jg e͒0E#ĔYYQ6 @1b0((c{y󧎈,F6r ?UnT +n젩ÈK iBUʔ3}\pũ68ň'SrC9r`hrOIᢍ-Y&ac03BARN,l. ;ý`b&T#Lb28[ ACG$DO*`B6Ja`Ӓ )T x$(=b"J&Xʁ d0jJ@b 衂.\0", ,6pD5h)P4PA%t*,$dI )b0A'`?葇" h&u`",,l)/Lb0":<3.tA=0ƞp8~*ZkVD<PQFY4dA*HA? Bc ;̂UW\) 58 lࣃ1tB5 2"TD5 (lOF9eͷ*r 6l`!`2pXnMz_XMC %`  , ;,ZAbdXn>4#(`b @=R *f1&j ⃁2⃄: 8JX8 ?;x'1Mx?h ‚ɗ Wq( d7BC( /@ doY(D8xD`R, )0@B `Q԰ 5X,ok) 8 @Cd/&@&6щFaNX3 Vxp13Yf>Hh cO !#(0>=H.XdwD|,DF6҉IJ$AorPdX8CDьe` 4(A̐=a? lF>!['[@!KԄLxrd49<8Dur@z(|AFAL/ rX#lCh@  pB80$2/P!f(!<0 @ڀiԥ(#CF;Ee( XЃ%t@ Ȁp0QO1L ZR6P3cT6V@8\lJ4QQF8@g%VeOB >a iBLЁ)zp#nw@@:K(@$ӐoxӁ )gXz H@f0% q`@=` h$$Wq6L0 oP4 !MhAZ` T@# a©BT-`*~MB̈%~~c@= !E1Y?hav@8P3@~Ѐ>B p|UP=!a%PCK2t Ac`Spa @= IVr:ɺ2֠``0DAQ`=t ~Ad0!2BkI%8CH!dS n@lPf 0 47]0@ ؠ [tc[WE8/@HAbi((]T4!@6a !chP>0;)/@ `7 A *`281A B߈YEn-L 20DˇA#ȁp>7;C bNX ZB`D x? 4j@c\`QZ6`|X9 $ u "7Ir8/(Y!0 P7\ x$<2h% ?hbI,+0 42>X +$=>Vc?H9>`3" x:* : x()h-= 9X5'ˊ:/[ Y dC²h;)'>+? &  <( P,H'($ @29Ќi(="86(:(#+,S; X>,x` X6FG;4`O"dBژ 0 ؀)H##P 0!<:X=..@80&؂P?`> X"0 = `<Ət4X0ȴ6.4-H3PI>Ah:("X=p 4X`(9P%$"4 hZx.>0k (HH?0Xk=ɽT()x'P P,p>h0`"I2`C0:H&H p (6h2 Ђ% >JʱYr>@4 C[3е5Ntߣhl;B3%6(x@Lѷ 5b:-z "4xPsS;C!EH30< </8؀I-p88A;x)8 H(:8O%ЬNh$x?- 9 pÌ,Θ)x01`(?x{Q 4h&ΘѺPO(( 88&h:8/\Ѓ: 6P,iX"UOT؁q <@ZsW@z Xë ׭> p" 7 <84h8(9 VЁ5XY<@/H!*)6H @3 "8 E5p/ LߡN]@J R3d 6ʐ4Q? !X (e H!3@5Pk# t%1X;P$:*>!" C*E`#ԶT8IXK͊Q1:H, Y=HS:.h=.@*!*p2 ȁ+.#Pۦ` $8'Պdb?_=p y4HuYOꀧ8"  'x !S X*-C'  (x0&'6ʧ0]>aR/ve`8!HQ-%x Z1Q/`27ph!ȃ5%.8>Ȁ7PK4`:  2#<.| 10c46WȀ)@D5'x05!`75@c5+f=؁,X1 440+h!P ,Ҁ+4p J1 @=Q^qv`=Q/( $(48"&σ x.(X 8+Ѓ'5 ;v75Hm#N95PЃ0>#*`'u5'DAI_h܁XB ,H<PX8 @dG P;9P ! XZvJH3@FM;mZՐQw40 (/pI =è2[ Sh0f=x]hxn w*3{6x T%;0A'Su^QwIl= jco\0x@w 0Pǁh&aRĽ:x$:8D!Jp%؀"Xp0p4X\Px0m{xm.>A6\wr7+H@+-?$cpҥ%x8Y1#Ȑt2 #NaP 4he@MyB-j m)ԨRRj*֬Z0fS/v4@i,xBXhg/l*6@S<@5*jr.= Bf`q4ԪWnZk K\񇎈.=>ࡃ.YcOS1Ɏz0X IX:p81CA6;kZ@B_A?GY O@\MBQUD 9)Z*G .Q~8k!, x${aoP B@FMztE+$@ >Bz-`>1A`K5 *hqENT*< $ <!:I} .<ܠ&Xp?pvC AAޠ$0(Sh&8S &v9 $&!@pRyhA4K]~g"%PT"ı HC$ Ģh WpX`=,E(9$`]5(`sJ>鰛(pK9~d 0 P ؂B@M0}np@{H 7`&}+\"L6y@'>,) t(d P01Ȁ x(# IRs =`HHxhT"p[g.20 2lfO=H(-<\hFjV:Џ@jZTp"vxAUaTBR)X0 R `/< ]x(:d3ރ܁U ?8KQ_L.N,`:By p3٤8@ Z 1 #P#AZ`ͱqHa,"0>X M0*=9<7l23?MnG/0ZЂЅ H`@(7gv`xTA7fx84 %*Na AM&/rI}t@#APH @;H D؅Z m@.,Ђ 4@/@lT䠂IC6,h 8 E>@9hP" %B{Wk&(B p= D !GAXV"?{5h`:< A 8 IJ0EY +3"B|@Lk(*B!K0ہhϪ,eG;M& FUr` ha cH J@Fᕆ/@ LMH3Tx`_8TA!܀B`X j[{0 XVЀ @HH8GA ͦ,=`A hYԁohXن TYU A-NN"PEp0@ H!W5 8 hJ(}` Ԅ AS5Od AXTUDDakA]"Q@A@Tq, ,|ްWHx@AX0@Aȁ @܁x \@ D @$ Vܕ9=H&El`X$pQ聵4H@ /̈%Z,uHд@`@Klt7B L4@]O[}=>~tf<(A<Ԁ `Aҟ^x A 4@< "<<^($D\A @ @c\@L <@i@ AkPYd  j5D|G |F vJ@9JPt@KA HK\  ߾[ 8@ Υ3x/QDA Rh@@ @@$XkEɒ倀 Ꭺ Ё@J}Km<{r|7 dhԄ ܜM(?8t,#E)P]QAЁH`'| Txtxa( |yl1,S V&xۑA@kA:՜:9jA\AXp ЍA@6T9b҉qT 8 nBkR7Xw@ G2HR `CJ<{ZD"LbXu c:;1$F3qֽwo>\`TC Æ@zzаEAL{`%3޴QDM(\zۤ`#ecà3^0 @4&Hc?h`kɌH'2(‰??.8 QLQY,J[8a?819b axa Z(S 0H 4Sc(ϯ8 3!@4Fkq$900`H<^0hlQf|7) q) BM9 @݀ 8BBC@A f  `3ΐ:b;V*RK<&""&& #:Db!а84$:,O& CFu*. 28"(AqЀ8 =;@Çb^6(H  !b:*0h/3ʨ,/?",#H,"c5$! 0 C h`+%?X !H <K%\yC+c ?(IICB3d p "䋆RY6D9 wX0wIexSM8a/N i*h[ɂفlA$CM<Q(>D\|bP~4 awQJF# zC| 2p7PTG3g #B"6졥c "  `ĸ vx@F`l'@p!A0{b)uq@@@ U  ؂rH 2H KZЁ?8`89dc@z,h)>DL5R<@N0LB!pi@7#!(k`ԡp old/`b:@>v7|>HbS`h3]( AKzy޽dTw/u L=@'AĿ/0 . 6}bHGCP&l: y rSC0/3D N@8$gh а )HnHV |4́Y@FzX` 0nj*$@D'$]6Hplhv77RP9/!r˃&@DĖ/,0BIl;RsN f@ xLԂ;T@ @$5Ё< o10 X bb*HNsCJB P 6=4`v@N`lUZB8%w ( ' nR$v` . @x " *$` :``8r ``ˆ`k$ C?R< $`RX'@H) B<$< (J`/z P |v9z 4 lK " `  j@  B  <' @ `&BE"jm]" tB ""SB`Ċ*ȠT} n <` T8MTe)$ @@ h , (1$ 3 b Pf3@vH T`<[`U L x`&DB > RC: R "ϣy@ 0\ B8TIR2l6;_97``K 'F~ G1~`( r)`8 @@1@O" @@~@r1b<X3@`/Ph؀ԀL@` \"@ Rg/  d $`}84tx4${[$ rJ (EUj jRҝ't`,F"@TD `D d8nǨ@%@ʠ  `D@ t&-x *  <0…(/} n@Fqlp#7K<2ʕ,[D2LzجBg zI!!'2;LĒ?,x9⏎ !#A)+b@sH80sC?x{칛$0Ё\)C8 t!6$ $ >p etPl0遇i}V A}x[tPPp~GE-dN>Pr: xAo4C -L%l+1hA@$ 4OP` rtsAEDeJOC?8@DPl1qn2!aBf$[d3t/@l>d#~`QS,TiYwաAPqD%\ApP 1y`PCqE !kG pFԃgP)$ABk x1jT`=Des G 0譒SDԤ}ф<TL@tN?mK(\Hu `dP;S<[IT(AoH 1Cs@/Fb(6~$)_x@-HG'QFYQET9cL AP>R&D $\Op,O

P & 8,S8F@B< > (TФ;I 2 / ̅ Jk@RX5@:kb% 8AhaH @`xG+! RA06 `]H_&{x],[ pL^ U2P4@ \f -~OOaAhdO `.P/&J@$4 kpJ`΃X!i@HP> H;{4-! މ*0 D M0a"@ 7$."d 8CB\ִ/ 2) O'd1uuPkhAu[ABF,B@$a2hj-%Bd f03xNs.|eòp1 @* HI,ȠlA/4ua@p=tP 2! Pgt',x ̠ oAPxPEAjs Fj  % :p |@RS xbV=vCp8 ;h0! *0x`#<;sy:"r&3,  T" zr8ǼxAAvxyajXb 4 @k* XCb 0{&x2` QP^X m^0! UE io`6p=N6&\' Є x 2 H 0X`3hu<H.KtB3̡xD@4`Ap@Ѕ pBA31a b8(\:( G,Lv@-dZ` 0#d`&X` H{g%!0 JB@>U‚A]3'!`& **;()  `;e–P &xư*]SP0 s$@=p@< 0nZd&;prP&'RVd@<"%Y`hPV &@w{%h `lp!]g%H&d@DpUPKSVOsX0}Ic`Q`PPJp6" }gO-p;C_PR Sg50n"pY{AE@% f~D@ Da0xK$=a# $xh~Kp,Ueu O-P r* QDpy@o3* v0}R;@f p@0`6dkEp7 q#pyv@=utE%pM&&=UvBA{{@%fH vpRPuK Yopa K3`p0sru61`Pp,RrfƆ+ M4@{py`v@с  @qbmp2'pH0<09hB:fsGi%J &UKTp5EgU6dV`L@$ P)0v?@c Jz@OS)dM`-lAyMb0u5gPZHBZw0u_`1yeėp|'o7h$0D4@m@?p}-0p(7 > 4S+HP@"exPC>w e~t`.u @w,t9<r mJJB`=Y1gD6!Y0&@}~@C 2 Xn Ae0= Uw 5J2`JPr P p=˳ г=k>`Gwpb4&q(@`CzQnYrzH0ĉ- @CIDPW 1H (%a%l@UUU9m i`@AZBae# r4 P=`={PE\Y; 3j p96{:_໚gN xV.>Tj]Y:p$e@!K噹vl-y0$`Lg |xQQ#` 070+@Жd@ T0MO@Z ZX^0U`Z.pN %p;Trp[Lx94,P?/ !Z0*cZdX*`_`F^@dLXv=/S4`vwpA`,RP_@-`7{yP;T8h E)g Qq@/ .3@v`p6T-.u%/O d ,$ Z7sEj9PöQpJ`dX/bg uPHKP?`g.!pP cA(IO!fP+\ѼT/:=F~` cPfMPJ@id`luN;_@ !+'zs +S\t}f`cOGWe 9nq9`г$Vc l}Ѓ+`C->@ ;P]p-ٓF MpJmAP|< aѭ-v*gY"-6(0Dp57vu^[^PPIN2BR 609P0~P_ O;jp mgp*Id*0 `v[9z| %w@5j%6@eZHPFgyT*`5,8fao bzo♤(&0WF+=amZ<zkT? W@"N0s=1W#MCe`Kp82nlyP=@1PoPΠ b#@+*(QWНw[U@W@%>#ZP!l@jMP@C{fY0pMm@E ?VWDDdA!s T*n - s p{HAZw p,T i>pB0(xsPwp,>@npsZ`hspV@'w'j .^B407]4; bLӟx=`f`{Qs"p(h$EuP%Fx-2m2FP,N0D3&0PC\.1SӤG)~ xrϝ;Qz p-# ?А`+xX8i깣g;Fz̝k]!<00!ň)C,p!,xg Il'ObgСE&]iԩUf,&ppB#Oi?. dL`EO>UAL!2dhP>Y0B0@CB2s9Қ!PxC "sfkDO"2 XأXuOЏ 6h7 e(b!(@TyU%B\paCӢ:(y`.8h(I(`\K,ȊBA['ʌ;l@8Аv4h,6rg#47A*b….ء (+`%{5NA胏!яH "&"@>̨☁;aLaAYHv =OD#`9È҇-{H!vXiXjP h+V 8Ai Bw@}xB`:xr$ K`@0bccE%:&,8'H(#b{XЁ1?&x402xy $(`C>2,Cx/ *Xk؈K0Ѐ<؂P/%&(:8-X.?yDID@D6P >#X:98@ 1'8̘'-5(&X+p:(?`j#@+I^?>?0@G´(.&>x 3pق 3 H<:Ƀ(?  >P: `0` x 9&=!;H  p1 mxȝYC@ PyhPXH@0 @5? %( p4ȃ6 0WYʐ 'Х 0X8!X>5ʩ4#((?P0#D6 #M$>ę981?/X.wjM[-X Ё贂:NAZ>N>!Pg  8$H 2@')p=;8 8&x+ =((98~B@>)K!9lC +!` >O4h!kB)HH,R#E ? @?h4P?3ȃP@&X(<0I.x7}L8}70ֺ p3+88X˻03wx $83>0 ˅@ =7q>3h<,Z`V\djH&.P0w*/ĒYc)% Rh--xv()$p1א0 h"4k(2pq0@hc酘ʭz??HR:(g1p:) . !KR`07V[vK.kIH".xxze,H0!Hu.@4\8?P P;+k'k1kÐ.pNP%h+*Ȋ25&-xj>x x:x09xD0 7H&xh50L@A=X (>55Ё1W \x#HkEH+ zA(=$%ȁ4pI_p,D3@j\3'p6!#@-Izt̴@A T pXjn#wRY(p9M褃΃1N @ ^h;Љ<Ê9Յ ؃ 8ΛsOX<<3?h7Hhc7 Ƹ&h HF*G'X?X!!ة:`2`$|==d@脀 hc8Ȃ3N@1!Н5C9m0`&-K8&@1ht^4$$% :<3_P(2`$:uh-̀T @O$x(XW{ȁv:@05FLc @ЀGH؂7u.p7j-(X;/#T h}SAah CX\?|1}ڰ5-\D1W7*؀(y,@+"M"_^ (P |tm hLJ(>8<ֿk{ H]¯]Z bO8!29郿m(3ʰ sA3  \@XD8hT̘Oĸ#rH5U\pЀ b"g6cT *FJ2‡H1B8Р' @c !"0"C 8g83@ )>X EA )0Hɢ^\Yp``lbάy3ΝpBҦONzuj( ά%I?#R0SE.6 @C ¨S 伩f=]`ύ ś:L t2GIeCy0eE,<@6G1q 6jЖaBᱝ /ymaasC D+$CjLht"2`d d 9GlO>yD@Pb[jG}G*pclz@H,D/ dV|X~1J@tQEo4@[  8@Qu1LЩTP@+D}ai>* 0 0D~1fO$|Qa0DĆiؑFq1ߊ0C0 x שY!]- #$@" U+0y,5(69w0` 9yE 4p bq ,Pa d.[AHK pAxl?K߾He0B]jmL!,>6pA#([=ܩL 궅>}jk=a#!ߖX; PbFX0`QR[!  H&[V}c`Y? Ѐ VmTT9h=0` ؁q 1@cԵ9`RI낁06@ o5e.pu3V$43zpB2!ZhⰆe@׹h> x<@Dpt! <[z&eՙ@u320Ft!!p#৙ J y,"l AAH1ip@(:mm1P|` L@`?`A`L +$X\ A*ЀL7iH!p \ 0M nXCrPjjB:p4@@A/LjY@ )li7xYCPP@ G!W.^p6 #`|.$A<L F \@ M 02k5 =ۭPQQĂP`s :1H ʁ ^ 7I4ZF1+  C<_`PA uCD@ By@z4 D` ?) :igP@Ѓ'@T&E& xbD!G*T7p?3p 6 8L,lEx @hA@ 쀱i 4 AAH@$ 4yx D ` f`tAeA6D!l jAA8<BAHl D(_ HT`ADAZ` &X$ T` @ $`T`\@A@AFH@, tHhADDA VD"g$!D8\) A3yU0P@d td A;v#A: |UAA| ;4/"pxjA'u̻c}gDAH8h%A A6 r  @^N 0m@ $= d`\A' =^2(^=IT ip}f+ANd H+$ IR0L#w􀜊 p, GvlASAtDP l$` d4~ dᫀ/1cbXذʛ1=8Α sȡOF (0 +9ιxK3iִygΌ{H8@;33Nl$L#L S[ǦhZԉHضm§;@',98Fp&;b8@e'7,r#ƀ^F p̝}a Gf4|͸7,9S3友\oaDG"74 8BGr1a49\5UB@ 8AB&H,n?!#* 6!O4hj!P dg: ء9أ/`8(cG{Cl``ӄd&xx82r "zܡ `,iËh>>: 9ȏ> " XA7`=| ")x :  *P@":؁ =.*젣*M =(:8Cx7a0Xr!I9aeca "ahhLǸ` Y87D.vX,v C ;(T :餕38 r1\څ2Բq Nج8# DE#(F`\⌘jDËjbX ziKB(X B%0!m+H"raKscf`#9ՁkL*@2Vz'zE{3*Ώ3~P^ x 8?? #0"(`Q$! 6\ 8Ԩ; 9Ђ.#_6@ K30*º(\a 3k9Cf" \(XVCh[Pݎ°`$"e !Cr.XlDAr .@A,I+'h 0ʨ09fp < 7РJ`Ԡx >Hi@:@ >BL#a>&f fA`*0 1\=hÐ!E Dw|xC~p++j"ay0`\ Fp1z *H$,@! |P?A @@ *A3`P7!8  Yxwp ;0x$.@UH@ƒ=MA{@1F0|%HiP`5fm@|50 c U>`! 0向 @$@#D FJˡp!T6*x TpC&-1x u+AXA bu-pd6.O;pzl Df)A OMpeh.hDmj 6@&1 Ph)/( #<4(7;!4)Є?(bB! <`6 #І|%r?'r  : 0Ϯf+@~@ rFTs+['Z ׀+?@ Ġ>vFTEn` 2 Q vI@pf`$nF ` ^`F@B'TBՀH@BG & ` ` 6G@z t@H  XF O zH7: ;;FBt I5@8$TGo ,W@", 36 ^$ L`ր< _Hh  NK, @4@n9@ 6` dn&JKtB55JNr5@t`KTy Wu` t#gK Z`$8 0`3l(^x Ri&`ڵ]u0\9 ZC0# f&[&,%H` D&5[Z,hY7\Y ^*`n z 6d , g.@P #@iyqlVhM@m NhOh ΀ *b12@^bU@_`n Ul6^ Ys:pw fbB@l u `G B F HHsc) $) l7`pap{qs@b@%nh[`m9 ( j``yMsH`ƶ@ ,3`H`M[ LCH@ ࡪp ZMM~@ِ @ B=c ` @W 8 y' 苂` v@ ĀK jQOXyIhho/ H) @H q+%` Lzu b_ jc T4 ` `Š`@uo 88@b3" (@ tp%` :'$`y&,>@Jgt Nh@@OP)f 2$.`4O@k,4>\v m ``*& ׀~j ~9 ~@ ~`X k ` s`в׀@sq&`%€ƲYF@,Q87j , @82#` 0@ඒ "& (z#` @e R~`q @Gę~Jl:@l$e7g Rc`ǮJhƖz `F`BDL|`L X| "`9ifڛ#P./@~s\\g)e`X`h  9#` `Ɗ w9 h`x | D` R@%&ڀqYR`j d2"o ` [& $R$@`TZ] { 6bb^qӀ``@$ @;W hFd`b d;;*`\ c7"$8c$5b\ @s9@gi| N <vfwȁ`  f R \@N dPi% `N@Gb ʚ#`ƝnThN P`< >\#4@jt@p"r 5X} t`  F%z@j5)d w̯ @""=`Wp@` %>} NYʠ 2`D^P r&1 Pg ]Fܷ} @oj` & j@ @[6 hK!=99b址Oͱ݆ ,$2q `pp 49 s1Q1.`1|i p@`C&`1^D(+U#>xi+5z$Yb~&_p Nk@:BY? @! |`mp~$( EvѠ!#Q7 9xFxBb‘8SLDpr8K*"h!bKh8F$QɴӧP23G @(5ׯh+hӪ爈/D A6sQ Vـ'F8``'`rtPB:2kެ<Jt;eUj᪂ :ẕΜsGG ྽T%=ArO ~|R#F,Qxd~XqNS>s@@DL-5@W,@ E_h.ZFhB P?HQ (sA 9TtE -(`#VP_`U@!Őd!A R|dPCF)* ƈO1,&AD@@yT-QaH P`pD! 'C`$j4PQ5&X|0*`p@ )p TuJX P°IxQ&^B,n `# *\B T`Ě&Æ` KHQGZdqH!Ez ÂZE  8#K2#P%\F̪pC Lp0 (hqCS,9f@' VpX"F DݱkH! ktu}9 @L-}4 DCstGQA| 0!X۷$G|R0AM506p/<@}౅ 0GǃoJ@FD2'&vaJ~8!A awfP"I@ 0CȎU%Y4p @@ܦ ?( f}{tEvЃd4(@`9m{+n#ȩ܆ ,п!B~FmmjB !O P8HanGX1 z*?`LYTPJa#)LZIM>`$ << !+*KS6B&=J ̀Ljf@V_I.!j$5S!`6F '(4 yH_Hp rB)_x Fȁ +Ȁjp4 % BϝBBnf!* ^]M8aQ d6 @gń5e =gP$ xZTk!؎E* h[rxK{y&0HAȆ!TP,P CQ A>A4MA @0OT\n! z׵>*|0`@a~@?~B ?`4D`? tT 46H"@_.01#~P}!HYCp#!uPXu|=Pn`f>%B~e~_`T'p9wPan649rre#pFQGl .$P9R5 LpG!`Q8d3@[prBP-]PC5@$e!hhD0,V;|g1PDФ]Cf%Lpw(suToY0rF2KM%;@*_ & yq;@bmr9q1p1PJb`Q6C_08P'HqadHBu 7td~ s07:%<o`e e"PjPR2$P`e~QE,0I Ph5X9E)H0#jLPfuRpRu,+#1pGeBn@,;(Hsp_2%vul9p7O `UrQF0X9:8?Tc8)^f%yOpezfC0 6p53r_`4?& aY!A &S 090J!TXa* \Pu?!YQ)5kEjye`?qi0*U^5""uw0(lvUe|0R0eJQQx(@5wfFQS9 ,j_5(%kP.PO7YC'`62FV7B$Tv#02&K`w:<T#Qn#o6<:"ss;jr3ss>CE08%P`#:$\Clgp l > 0Ip%> ¨50CL"7*Ohjգ*"+p@@bHyy@@zU?0&?? A=-Zɗ|~1j`jf+OЁGVx .Pmp~3z#LPBj GCL=:B <oDa* 2(aBu[c Zt3F5V=rs2PlX6r#H08kWwWL 0DPmVKwCy *|%Z 0! LȓI @d 0n'9$J-01pxjCr?8`D0$/jV-yjk0=Se1k=ӃY9@>POEUu@L=E@!7B.q!nP `#)m891_0=\(KpE@i3y{<0["wBQK`X5 >k#PYP>i h=+ .Bgzz0ɲ.Cu/,Y@p#&e~Qa+`J7Fllu$+5NkEsyp\DYP` `PX@FQc P#Gr{pNp@ga!t,%g1#Pv@tkx0Z>=lpA'|J+T;c>pH 3wʼ|տ>tLaP2y ;c`2]}O *0g0g :0Y .RBRApQpX~yrp\B,u Ĵ1Ty9h>/0&U;D Qjlp(p&_T\}T@z-@ՃLk/@o@J0P/)_(3@|P]$NQ$7OM`uy7D0nzh%0upWSZIXPUFO|Hi&PR' )U*`t-,xp(` ~W@Ap)ep>pItOD@2{zd.j~dlS,40 'Ni@9`#JBg`1ſFPo`i=@t`1"wd/`7m0(_|_~dc c@ DPB >Q"` A0ϟ>{DgJ'LpAE02`"Dm!$^x ,I’H U<`%% NRVlL?R"t2V>}RqZuUd@A< &M>Ppc:w &`ʕcA˝YhC0ƒҭaq#^RIALj! i]z>Hh$t՜!"b(Z9^.^Q<{>\@&b c@lxcXp?>BD9:FH-۪4>&k!8b  38F!E‚!? X(c-|8#9␃Ʌb 0S!)& 8#xM;A8s:6b *A#@# Bx5*QMɐBv0b J:rR ! Ug hm.0(c=~Ac H!B@cN q`kcwa )xh878@%<̷9 : > "81ء`7 8"bܜxiܭ00ag9-,N0;ɤ0P0!>`Q!Pg~6;P?b 8;3٘:m,آR ozḂn a ɷRHN5haWGoQ @`N I(D34(  ^  v+# (' 3X>~>bXR각=U@7c9X1~ xxzcJCA(!L3p8 fp nhI9 j5ؒf-Є%ذ` /aCL $AU0LƠ B 6*T! y ^Ѓ*$a8sE.6D 3  ! .E ?p@b^BtGB&0 P4ԠS ))(! @ j k<@7q!BxJVA  V-aEb`;tX]`;xa|@L2 8İ0s =  ~2OceA . $U ă {pP-neSv4ԠZi/8lPP_Rw 9I; cp †-Ġ B n Zp0x7F. ۂ 0 Јvp+nIx Ќ /^C6uHO R4/ ,p 4 C^@MT tЩlC 0`{İT`e+MP$``|0'aC !|( 0Y/` ԋ,< L9.| 2 c6 !)P`)  =x@hׅ>5x`%Pzӛ-\ p'ip H`AH@ ;J Mtl+c>%U |\ MqC 8*()& %,BUS 92HM$Ƞ8 6XA|,IA M$@_| -|4  EYHhJZ3Px@4!{` BXxh$, v௟%*hb†`5CЀ TjX@B}  $@0H¬;(A \ BƁ` X@ p:Yߥl#i?yS AIy $AZzUOR S|,t X[~<\ 2VЂ'P}H~| t`)؁Tj C070aQ {p,! 1Xgk@}@gtP T6|d`\ 4ʺt $EtA .9A+P>>:}ȁ g[! ֠'jC>R}=ȷRMjLz4Y oa^@ Jal@t`9#Ж̂ÿ|,8J考+!8/ك- xKx 0 ;ȁl'888< > +! BhBG9$) :xNJ@( 8BHB{6(hC.x+3x0PC؂ (ɩ4`ĂЃdkթ;xR,* ă P"pр $<U=%`P48f̪!(=̃ <-6?803 ?F0M79"86/$Z^k)u/\1mف_OC4A-ǁ@058<>pH.Z& OQW Aq&R3[?  5@] <|  !$H. 71pd>38J8+pZ3Pؕ>ҳJ3-09 |.B”K h H?Gi0h 0%1;L:(pou?XY5؎? 0-X!ʎ L2"؂. xP ( ܃@1-0/-@ˁ ΝAPy,\9D2#xq, ;(Ї68 .ܱk)#ȷ3?x QI87`\='978ـR?+x k1U (8+9YK%0؀ %%@0%2Y/K6Sq:#0`/G;X(;PURm9;`0788 x?\]7# DVv;Ai=A9 `̬MT!8Vo%% wC: 5?zր5B5:XR=h؈}!300X؍?(5Y -@WuYZ5ٙY(@ `֗ٙ<,٣>h!@ڦ807؃)] 0.M5) ."X2`[`p1`;/<)2M4[%-sUm-H<`ǵ=x "h .`&8 ]6`uݭ(߅/ s㽋>(e^!E;GIF89ax(((888GGGXXXhhhxxx!!MBPWؾڥ2,xH*\ȰÇ#JHŋ3j`Ǐ CI2%Sq˗0cdh̛8sɳD6} Jѣ  @ʴӧP?hիX. ׯ`ê40@ٳh6$R۷p:6ݻxΥ߿)La^̸1 Kl2˘2g,Ltխ^zVt[˞}sK4`P`@tͼD"X`\5#7d vNs:8Pj  0@A_@ 'd,T 4ml 7짟F 7݀ 2Ɲ7|m A ` dF4оkEERZ$Zцx0zRbKˑhWӐoipXʫG9oD]'ifJ>%@ lV ,h|sA,>kȚ>0x:J!DJ  [iC x M1@liw(r/#+W \uZg;~f~YrPHB "Ael  \7xX!`HΝύqPDL(A9>$ > 5"@Hpd5Oq[ IF;XeEjYr!iQ pd¼"ĐQn y 3I.[8%']w"bpUE etca[^T`."BZ%#Y$/mHH~瀲"=+31i<H%u魖tT!:WEA.= =`*t)}|V)^"cOh~"$*g(tTUv\.BԘӢBr9DGEE>IJPY+U6k#ka̵֊q=ס6 LIb5Q\B %]DX ~rOb\!L w)kBՇ >;PPR gOa M.4#$a`-LRE\]:ZYnz1n ⬭#ݍi!-fEεC`Z'Jљ+wX>K; ۈku`E ](iVQi`Epq+Oɑ@n+׋+]bs-Z׺% Բx>tGJ=-)OnJ&M=.NpsnԜ+-zC2>#7TcvS22v򡐨ZS%p+arVdfᡠZRL0_z\n_A9e*xl)*4U)*S:H:;2:.2I`HBVr|znFm;a,s|ZE[DnHާ&* f7¦(kOu#C W̭SQc4 YEjI`F*iC%R/'A [ Zdir"_Xg~hVS1r1r(ScBU/b7EҲ?ut}T17>W*B`-2ă=nl^DqbG13J8$Hz뇒W;~THh/{$x+5436aMNB7l_#qa'PK2[Qh4QA#X5VbLCY+,Cv)RCscuaU"+Nj"E5#1-dVOg.b8FVB#C-2KSx[.UWCOщ$!#$l[%XdwO*we'vo1nb㥛A%TS(#ޱ?2BGEDZ4'D t3V)`؟$N#Qa::h$Vb5k*R#Q,&DYhAØ9ids!~a 0L$uٸ'r}#DQ,[_:*v~bf#+BR’$I.ׁn*%/&9CbJ|2ƑoERi_MHH7iXY6d!$dXhJ]T#P_ogF*3/B2 ,M=?SQ:ɃHQZmihtᧅi6TAR\A/ҘêgkR#  aGb)+ŸcëGY$!6zb \qJ؄F9d+m"{%>s>I{rrpB&Fg26;s7dMz.& |BB-+SQa0BxACޥk9g[kbպR%0eQAao|$d"Z"D<7TB(QQ*Q~X5ti>@P+As#(I^DޡC'q&&i6F*SQ!~;Ss/gK6NHkpӷ-6\!(D.19&)n +#4dV;!G/I&P<ຢX*Q2;iX~Ԝ#q.;V.c$]*qUIa6K^۵E Ѹ]6sPL]Co̝iw&af,62PJEl.zM;k!I_[<,12\cI9bu(/BCD .21$?$$#?"5vڛYGI aQVA}d P:&aaQ !>T8Y12$1XU%??%ɏk4,Qq.6*S2iB03Jlwk.AR%%1,#"/{8p̹`ӉMZ15U!(ٖD>ȡ19A#-IFURMɜ#&қ2#:ob>2xDvrC|K7BC4kqt3qy$枍(H48h5+UfssfQȆ*)J2E,SƘApDK18GMqmS/7X?/,1p7KJ=+ZSO7(o#A#Bh|$qbb&v!0G1Dqp$R4Ek0Qaiޟs7h㦷a`@ X @(`,*0PA"Bf s5myS=}TPEEI{>|@8B\Pax>0`$̯a=X@&`sN.5Xbƍ?~@] <0@(@40P=Sm 4JD 2D%L@rഗ?] B6 a~@4'&r"y @&i G',z*`dAo* RK,Z2@3X 88(+%~oPA!$2{ v;-r% Ï5|C@Z@,5 2(( : w,N;$jKL3mJE= 5^K H$.h>/^H dUWB)fk&lU(E`׈:Z*/KnzI2_QMWwHɮ kkXb ŠHCbyC`B2.F6csՠ$t9ɘ [j`-m:r-R3LGO_d<KUO k%f#(Ɣ$*!k䌟1~II7Pbխqi,"{&/)b( $K=5 ZT0(1n,8F<ö+"~Xiכ$ HNB-P 7BJ. &|rWL>ze+LJ-(H^lb (1οj͙K$]_nL\<)'+ $SXS^M 6<ۂZ2lDu)M"#V?l)F&*gcBRj>\F&.ĥ> Zʺ<52/+x?ȼ[H "dI9Śt#]<IMӡwb"S#2e8b,:Ө2t!] G:D HUⱪS-# ɖ&C( -Сt怌 T9*_ b뇍POc\+~AYCZWQj052TbKJҸui`D2)@R\J14CSbzL-PC|Hʴk1]᷸T"¹K- 1H$^XmWI4m&9ŀxq9V:b76H2<\MD$2X&imtbHR)Ye+w#lTIAjNq M/&H^sٟ'$T9_qkrЗ{qQjQi=@٬ ,&]Ss0f"TBލ0h i(GH+bHflقbe,!I׍*!_J2t\KNľS ]&RRm#b+"?!5Ѯ ZP"A//w{:Ks~|^mJqbQܥ0f~S ġ^0 0XXs'b":8ޢLAа0 #{5Fя^26`zyA "%+I^#[.gI9(67K=a@pA㪋 ^y'+4Ix*?H2̘C:8h i0@ 0+l1X-+ %)7BBL |gK C#EtW=ϑ 1|;tP8"ЏPi2 Gt {) wًY8Z|`{1,!3xb-J-yƊQ3(_H+ǘpXD1 8R21YAGhzw:K¹xz|Cu lQXkUZ‰XHZF1 xE(ɋx"R D)rAEA3@ "+c3D0 ؘ2L |Y 9By  e@&֐19 g-ɔ/;ռ$XXA> I7I!X1Lwʘ8{*Jm<ҭ8b'H pw_ JH⚢8"M⛝MԢ" A gCCљP qF*$ 5O Ä7*BQQwY 9ȵ)Ɏ*H6k!(A <3y'Ĕ9C@JXj1Qi  oȼ<ȕ@w! ((x0 Y2Q.$ i$Q /+a(LLё`޳ N^@٦myFy^i!ɒߘ*b*)C"Π$j2FA x'SG: " R !ˀ"(ь ",(VTZyZ;E)XՊWp9 :%@Af4O Y HXڸ- DmV,k4  ]*D A1h "!B x|* $!%9q9ٝR v!R(*0ɉ$:QPWyIp-BN 1b E W ߔ ؋\\oQA*[H:<Y |]q2 jZ ZG]"\KmS58e4j 8//󓸘Lٯ:,bb8 ta!*Y @ I ːS [Pi74Q3hM ^/ . YGm 6lĻxbR"䛪VgS 5U,$ϠsaMBb)c~LQ#{QYBCq!# =@AXEz6(vQp fऋ%z'@/E>.e NUCىYȊ}ê5퓿 l[.IaBLݽA u: 9P噔dC-)pK%pK!) VPa-Q=1z㌰ 6m^'E: UBSv􋤼!(Pՙ` ܨ(/s4xՐ 9 6 P6edF Mh_a@,X]IqrЃ֠i^K P?ᒘ,JWqBj H[ z_x t ј NɍP-. :!!F>PܱƓ biXkǽf( AzF\h*XaP S!$y ^=X ܊o"`U ٞ d&-HB[*0qV6Xژ9 !Ѷ.#/S?RR5p6$$1X;%E׶  ;/n"=#&x Ԉ<eŕ // OI^rV`k)쮉(XLx? \Ҍ^2 )yHJ=%- :į@':H-(Eϥ 8ɋY݈m XjqP 39@ Q{@u]yiWt $ߐl <V"}xҋrXԧЙpI8 KIxUxW p)z ڒQF$ x_ ܠ1!}U (2Z ƒW~2i"dn HXx7+T!K5)<ʔHCPgҟ_$`ҕ!T&Y6Arztxxf #({[`a\f X)q%-d""zK^ِ0Zބ ?⛁Z/ !8ع0 $p H@`@(" 0 ҁ Dl%̘2gҬi&Μ:w,`@(@6X``)T|H`Kt0`Qx@4qݹ @僉&87ңHQ `4)ҤhNjw戎yeUAـG!z L@Q'FTy$ 0Ф@jKgUQO1pw`QxE8VyR@qEPV ,Gkt ]zv&fv6h gP%vGM!W !:.;PbDRs(TjTVÉVZ 5Yqy/AzD0W>T N)Hvi(l-*`a~!R{39{y'\-Y[Fe؋-*rn WꀋC|dզ WGhp-ѕM$r'ruq EUOUUmDPA g΍;(pOI]Cew4A$x#H5@FQv(2:w5/q*D`.nqYD1ejӔq3EN1&.KKMrjMVFSڋ%I" o%D1♒]bԄq!o}&?T)5:Ӂt67s#:b蝍/Ryo|3鄫{SBgs&xKL yҧTaMTߪ2n3^YCt+ JN,Ir(I"{W׍. idb~[b Q$Q!eَڻ FDmTQHGDGY>HH 7t\I",FԴƍdR` jFHuNHw#V_BӴ#Գj9/ ke q,4/zo7 7HjFIBWAJHmUTU rzYn$F)rVQMp]K,UX8HtM_Dσ,"~[И88dkY7!N`#bo|_;itƛ WqX gpJFS^$fD`ەT4XXFm!E]]dD`DxLTϡVCXƅ{d/EWpLU<ͧˤL#R4tiE@ϫDj[IX\= [AN$q-aKBd)(=e.*R(J jP+}sAL0 Әy^D_J-O4Iz،`,[`$HEFwb(IQAO  qgpFRAq3>Ι9FQLl}^jIwLDj4bLYN$)*F5PJ6Hus^8QF.ɧ 99Y6ՋHuĪȿb+ӀIcZYHH~ZN(&r1\QM(fEV[} 9McW^KJFRW .^ɂTVŋdiIߨ"PtFUPPlw|EF=ӬR$ɤ Ȝ<[8c'=k,΄TzL`HzCX@$%KCJot0S.F~Dg6bXU[4 PbqJ,yD(aF_E/`ȫGO\z٣FX EI䡄GA ݲDbpE_d={2Gj )VI$[ {maăAq (sWK0 PI^P5k` SG1DFRiO,012 KYqdӸDȣEN8/k.ͼ̋UJYɫ=bUI0 фvaPxF$|:cfJTbLKT4$ΕD `ȂX8tՋ2IAHzSHbP{@_l֡3NL'݌HJ"TiaE`.C)b^d1i5aa r$c<ຖ:,L"-RQD_|359&FϲoVh 3F HUIFrgRab %ߺ@P_JmN_+E{QxR FsT jW=ܫ5Ī@וH9"z|n!lL,j >c%)dd`x,.̵TA$y9$ XyfO NFx4\Nz!Q>) `XI2aKIՆ)wImkRI$ڴ=o/6'W/ȏ/@W/ ;PQ 둾ő]!_+N_c6tDmh4H2v6#q`ŋņS)}Hu`/"KF\@\F{J4OLOTjPGDvGXS^CĖis3A +/]uuV!8!)'[m1(5vfhL+2lSX1-"u8H;F88X.vel,˼|_K&X֙C ]\Ǡw FPkNaMd8%|`m<Dž5gϜtALGxŶ2 H&垜O~e{ai\ #D0 ℽ%6X˃(nԃ@ @ $TXа@ *@`.tb ( @  \@pH@  ҧ7LLh(``@AU\0 PP& 9pI $8y Mٖ}k8`Lp'=CfּsgϟAge6 P3"k{C%0;0P 'ޚ0wW;uphP*&([5SaVq TFU SnC /62``:@0I.Jl6"*@:1O`"8bmrȶ q́^3*(s"ċDhB0Ho1 74" [0&JpR8ېJήCր|K2+=; !3*V!"u8#R&k ˫dPПjզ&Uu>s1,s *PV3D@lg:Z C(7J 8M0*MPфFmRy Tebh%:.3 0tc"&|*xsL?(wi w=Uh+٠멯U ͫ]:EM-ZBkRsVȮZ5pZnFLwtĦ@|eez,X#olA 0 KQ6R<x .,HX58y Xyj+0H3qƶzz .26pWvl] Lk׻>Hƌ!21l/KATN7Cz?e'sYZ"sZҢHQf#tHtk2"@8xn"`B^-QV^ɌF0ppw GS%>$ PUyI}DTN2ٱ# 2GDC9>RM۾tj#e$:b!i4CIn."Q U(,4#@\. %8)G 5"jfT>y#`'e5 c +oʉ$5c S@0e 4΃]A;NvBz W=%J6$|&OtP1@V9}A-G౓LL֣LF11W^S&y'7d\"’^D%uS\@ F %E2Fj1jE q _y.ॾוM&?Íx, AL)qLƤ4&{gclUK"a}>ė◚^mXQie#hHQgp>r(fdbВ5Ssa"u(ƪ(J*-wi‹\`)&^V6ڨ6]J@51LZ2UIPPA%YB'imh"'⺢H5ުH 8- zaR 82n<IPQOlPe47 /ɀ=K,Dǩ嚇 n4SOݣ_o4,!(s E@ *Lhr(&M9Nc:J3aЫ9yiw_YLV#WA2~{DDi{b-[$:|AU",GBRz&~ڵ!ſ'!Pb .}"n4|4Zĥ,=_brn+ QH&nm(e84x@U<'j6 +S|Str[4t3V@ ORsJO#<|I"2:OPS@)݃Ww\<͊YNp#dy%3McҨ'b'?f& H RМ`- j$TFh0C.#X*R7:eedDb% 2CȤΜTzYQ-JmDN.3lKI |/>ȫ)ŔUO##':9^rj#=&b'%>[r#:0Bѷ(KڥSG U2F*Z . q&h>Mf"N&tbE1 F0!HB;x+mD3']N`Q0Znrg%ڥ m\d4 KҀ\.R0QGZUNJ/|fk7H#tѴ^nPӫK㶧h29is}$J3@Vo"mLjt38EP1ڣ,OBqnN(RF@)-').07V4=:,K,"%0+<*LBkpjʓôL|$# EP"FfC3@d"2Ҋ|EA=WҮOG8,5.̜8SFM]ZLSqtx&cR4bl.3(*L"I(-jBLLN}^?Me]T!B%_,D'?LT0e< +>u3VJF-krB$CJ~,|6oQ0"VBFu3PdCWU%:Ć,&r+''iA((#-vU HHu\O) @"U~'Q?S)S$8Y"OL#Qad9"ߤM&H\i 0UQh20)\GRbB,TZv ?ܪ[EV=gĕͦ$6vO. B p4T4֪Cq!:IiF%iC32:FȉPs{U/r$ftX|&&OFY3cU'V"KHˮ{!jM6/#aV#;LƦVGM-LqdZyoh:hJ/шr(M,0f{F*9pW*IDq$*K*gRNJh"ŧxB:MF8_EIvIî@".ZˆF}@t!3V;Q we,88m&^vvdRp׆D`-RFl)VJ\b̂Yç>|fG┊q$7jm'7i-.G{X(}Ð\.f>,Zovg!u]vx E6<#CvD0H^kbp=t]#K萮4x -kSYBggho2+"\flbQg k~1|8}}4Ȉ3B8Vs04zXC?K'|L.gqjwDl*ie-YFDxy\-:w0{N0eK.VlBb %HRJgD d,R9Ts#]´ aNJQ.b2"8 ҩSAW*hlq΋IY}S78N%Nf=1`)H.Le>B"M hLHT>т,P ֹ*#gk-1wb2-B'ҷN+M*+F7LmB[ ,N^3 B_P%iU{ڣ"tmrw#CPbeX.C,wla~Zm]"sBGw{I=ad6^׎"!xi'{ 3Xo%2:%&,+2`62ګ 1;C+Btf)S$u!j=5#nMXZJ{5"?u{T0ǜv1IBA_\EXPtt7#Ww۷v#;|{\G -#l25"#AflG=54Ӻ{"B{3WGV:g0?;YQ 83i!0PM| E7[HDMEC1@̛=c/pcSZ!*d͔O*f/\cAd&H*c3?7,Z6 m7Z@!NHKh+°\&ZE?Y"_/H,\= C]\4hE!̓tρϥi:D"":԰6@u&#'Sٰ<;dOj70M~tIݐZңԥ2eddOgPg>8wSdNHuk:_¶WJRG#ŨXYٛ %86-CVdV.dedLelG=T;Oq7/Ũ[GY$eh~mcM)ߓ_sB6*y$hFD00~٧(j1^(]UlNѣqD/&RkC޲-$$dKst؊?7K}*o1/6=Ũi]\>#6< d~.<lJpTi2=m&: ߹4h5'] ?J"򇕙d0+P3_=,^+/$Y+#Z W'uwVqQx'XI#'%e{ewX#xd,ͳ_0IQQ[ J>?U/1x o;Ö_O.MTc~@<0… :|1ĉ ,0hT<2ʕ,[|AL*t,ɀˡDm 0(`>Xը֭\z]s2.t(5\,5 rp:@@#͜>H P= kլ6 Ph :='0,<.ضKn 8  \Si ?  XmHZ~ p$ oݵ~xk?v]L H]$} VR1`@T @ɽdԍ8"`BvU@[6Z{J.erm)5yZjY!%9؆c KTu^^5QC0umIh(@W,@H <2i @HiJYN@HZ C 0F$ vou U,D=ڦi*O.BKm 0T=[XmnV ..Bcn >>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H*\H0Ç#JHŋ3jƟ5s6Iɓ(%^Y &)cʜIf1W c+l J6lϛk@@ojʵk~X d @ckӵݻt[Ɋ?E\SP8\c]#KN@)A# FӨRVg dRQZA@ ,Nͻ74# 3?w~\ @ЍR2p>&M PN\棫__0*Օ9"E5pR_8]a{W_ѡ|p@K(DhoF 807PxDG0q@80 tA*G-aF؀,&bBjx 8\v8jGaXAH\+8pBS]V|A AD?PdA^`! e@phev %qZ(VF&e Qq .Q B0feKd,M+AkX6jD,pAV!€,FTVF;F-M=Tdn\NCS(E>$ttL IذkL!y1qTz.PP p@]QDî{E&e4*-( I@,dE (ДՀGq丐G&F8XX.gD~@sGB)Pw RiQ K4aA'4o ebkTFDиd\P2hdlU +5h&CC uAAaA vЁBG2 a  I@5x&PlCd 0ZBCtX@N) \)Az|H + zԂ|jj0@ %( dY:pJDN haTgt7HL(  eP@a#`l,+tR 'C{8 @&$5$:6 !dH*"IB> 34 ؀pUQ6! .70\mԁa pQmr B;& @ .e_  ;8Wӂ x=H 3 * ?!a\i @;u4H #x p%D Ӡa>C: AUa(Ѣ-LBT&q<$@3BB@ Ȕ4HHx7 Aeot5κ$. <ܔ s8L >"` ~pЇ<` r &n. g` n 6 0J( QnPG,!,FIv:@qC8{-&:fS̠Rn†!DA XAA1@00-2@@,@@ ;AS RM?HlW4hBRp`!Qð. l-'$ ^[ppO Pp,_`P \T_ dv)qD@nr *pB> &ey|Ѕ1(O XRb *D`M`t2Dn@)!@xnp!  m`H 9`+<CqJ:<0Wb E% ,4`hC>\a+o+nCPLaʼnGpXh$,k~68!kpL*Gz A>[$ 3@фF n  T 0 hK @;j0a@\ "H0!.c #z$QPpa.!܀86 $ `ρ 3ēR~p9<^5Pvv \@>G- Z)[h}}'>^i0N^j~S.!@ցNhJ0x_V@]535 (Z Jt}R'q tq`vE| @ a?bmFf$uT{1+ WG=2@@$`P@ &Pa@ Vhk0{hPN}PJ `@`_jj@qTu1"u!]H@ PWP|uneZ6+`Yو&v`L<٨>28Ks@w?0 @80 Xϗa#@6(AJfkvJ X,&, 90 p.r<@1 S2eq&,j\g@J&054Y8 XNO+e@/PdoO_pdP )Ko$(1)o;S6?yhRpA3Q 'tz{Jx1`X0@P xkh[N07n2 9I780tq줔S)w  ^O_0z@@B&_}WК&q6O-Nv0P PD[ ?@ 0<~ e(f$P <+y*$@d~#`"Z`7ع `D)v%2K @@ &L`2?"N+PraK0vK 7G G1\%|*"@,hl<` KupJ1T&_nP0.Ze VtyuJd"1dDt0?0R uM95!e  a@7fI0p*rtp`xps%A/E&Qz0s]y0pxnWū5h@zyhgp$0. 7p*7[pE;0@E@b5O@ѭ3NDw:3werz3UhUP@ "pc-ahQrKU <>OK5q'-Kpedi!r1pT VBxnem/١w yl`IkYPNdq +0NZ\wpd< B0^cm,rH)-1{ K@5t"~pHR@t"A0|Sl_4pm0lpj`hqM0wzp7P+2)P$5/;Y&{t,5S0 G@I[-!Igac,7W.R N[.Qa=kgIAiŰf"gK@V!p`DhZCP8;Q@K<j:I("b 'pw Qf@Sf0|&3p98E'`4`f`2uHn/|EpT'%Oȃm01lLXVI YtYJF|/`smtpjCkaki?4;> e e%0(  P]'e&WP%75Ueʭ1Ar0pXppTJe;peO1 ]AtlPyG0~bXʫM諝`Ag-xq2pG-NEX@Q92 a0 07a# /= ?* c*@Q#;#C+ ha )4SfL4B| Q9S?`ƂT5jJU^Q +F8)rp`ĂMA!  `aT.+|`?@Ԩ* ~t8 de$T HQܬ`8@@ x Hé Ra fUc1#0`2vYI4GO61܌Ĩ%..>H# :`G**LFLP1 $}z w*\cHC#F롢 Hx n*g JH}A d&b0[@@VS c<BDGġizDr9 ]p7\!*ZP*ݱ !JjE,2 y -of,06:BP3염S?P2̇-rbpP Yb YC|68]+"R!$VԨ4F+̷#o&cܤ8q 2ՕC~,iV(] ,"XH!+qYqe)!jg(>؀U3\-d )SQ M @]\Xp8ÒpVPaDjl{c.` 1N9W6!#f8Y?-$T> T ࡑ@ZyY ApYYbp,$k@GnvA P(7C ސQ.}p ,0(pRԁ j@ "#ґp3\g: @XA :m*j; R2b\A N39I 2\`DLҪ7Dw@CԠ\21m^NRϖ@mWG urP\~ .H `܁aBP8m&V *3Tʗ`,*yx4H6  L #wp_@ +L%4l\I>Wdž %C~*;D!OB?h- 0'KB&T&_mՁ@$=3> ?m"?GݒD>XkHzBXz^s!)p ȧ&,s %, T#wP8ep"&Pٹ=X6؂E pf-N?`caN0?x p"0 # ,()5 h=b 3(R p7QF2/@@4,%P;7(*@ `2@9(1!7P;ȣ`Ņ`2S'L+Rh[(6d=TG h=Xрfš ;+r.* 8*sRuڵQP` P@ly z@(h(,oʶ}90/!li Ն\¡XO%"H9Ă8x xHI9$`) 5m?uu;%rO=7`@-[ !4,:JP(us"X.(4傁5V "l.p\.)|ϭu3#&\ڍ].`,Bژƥ ȁ0!" Fxa\x3Āut W+ ;Xq -(]-k X;HXe<\7$DX3h%  e Ȃ Y܃<- 8X]1ۂQf98 =()8A. (t;90)D9@Ę >eH'8h?Dž'`Gc8_pc)8&؀F2 3Ag \5H PX +2p)5 18= 9H.(ga87H8Q69AWva7{)p̋ PŊ 4 hUI) fb+] Z9ЀwЀ@ khk ( kNf[  9chr" 'p+0bֿ X8`?$ p(< ( 3 e; 8 r5->j ;X[>^`| "`p\H{~1( w,hJ~ P ?Ȃx #(  -H;K 0P\v ȁʙpcb6: 89h? hnͬp}j(H .`ͪ`!;&0@J8<6h4 (Ho9P8)DlL=*f(`0 ` e+؁90=G)@ޒ! *8؂A==x>(0؁*`(T2#p>,`H!. `6dЦU>@<h hu) Xۙ<&P8HX'1f C>(02H&VOr* ?})w ʯ  ƜYxcur?pq 8 %hx,8.H Hٓ* 8n((:66%/qkx3pFhp ఉ|Wd& " EԀ&S;h ,9h/ +x3q* Ѐ_ELI Fß 23  8 pjyKH`6`WjO  {FЂ .%$zGΗ9VG lwq?Qw!ܑ 4@U9b`6dpPFR0aG !`@IB3SC~4D 0WpF`Iv0 I{[ 4@\XB 0 @Lp/A y(FV@0T@ ?djI/0B\x[>PQP0^ yD `h pUE}R`` p*Ikp2|@@  ^'Hj$ uāg0ă xDC<a0p˄ank vqJZ0T4\63ءꣷ2PkjUQcǶ8xQ*4\f @vuF0vX -qD!6Em0 D-o(pC\6L0A 0pqk%\Q? I0,<T Рl Q v_A #Pd @^ 4 #` 6@ @I$ID7|o`  ~EN*?(@aR'c f9XHLVh^ I 0!:yH 0J B3qhD1xBHn & ^  b bKB(hI>yP Z(Z8x :P&Bd+yPb= aP+gt |!Ca8 &80f>`<@@ A$`jH@;C0 7lak<# !V@Ea3 ,)@$')?A$*А!)UT AQyH'@$A"BL PM5o> M7p @pUiJBU~: ؐ0 cH h' 4x5a"1 ЇPCґZCڰ85ĕ!8)Q~ E*@eTԇ!ZuEVŀ^]K$ mA w&$ )xdJ@ #7Hn&аtoCPB x@+J0䠀<@ds azZA %؁q;褶?r֮!Cp1 13zCh +ݫuݬzgPiaz>4` ;:".C^6m  ``& faeRA?Ҡ!oj~ MSG=-Q@4h,D?(q@-R(  c rT^ 6xAR[{3࣒/ճ ZDk?X `7XoH6(!!OW5|{BIryc 60Bb%{A7!hAL6{2:;g]8 6#g`0 9Y,Xm@ CDHCh8@E[LDPADAD HA@Dq Dt )\ _4A^@ieh C0@[ XJLPA6@4fh0Am lDp D 8AaD ED ^hW* @ĀՑ` (r6,,AԊ @IpaT@@D/P( Cd T"kNDXtMIL@tZƴA A[0ǾdJ -!C@ȓ@x A L TA 8Sl0DEA@@<$A@TF<A ƸQX4]&ȐG@yS_=\Ćvh!IDyF e:Ar$j@ $hC0\9^n-mvfcdJIP @,@PAXIAv`lJXj\Ar t=EQ5I($<E @F܏FEi=qt AtgڈAwdA&c !cop. X0H@b"d*-bΣȗ-Ð@@ 4JSTS$[8JQ d@ SA@$@TI J@ 8@dCĄd@Jjp(ԀX2యDqAq1C@ AGhA@kC8@ر&H XF2nC00ksAD Tj-A4 h9N@%;? 4AU1'?o> |<tcrHVZ`\RIA\( n,E?<23.$6V@A ( @ Sc$@e"A PjT́@!ubP2z A@`CEH@Gdf@hH1\L@8|JgjDDfy UCFʭҚr@V24eڲYKE DrAP7,AhxSjC`(HAS1P@<+1́xΌ( D @kC hTAxE(ԁnw @ ɭcLq^'mOEE"U7I8vyG!7y.\8m@F(Gi)437Zx6 XLA h hȁA\K~mtAq66Ήm0@D@DCJ< Pf@AD@xA{\_6T|yj<^z@`\s P ,T9$@LH`86OA:vz|q>#Gh@JIJ(T𲪷h@W@( h(2ITX*1DT6KA A$ X%I@~ZKU@4JċA/+XAv 10L)Fj@ΓD g l DCЁl AVQ LA$ {A7@Y įtdAdTd?E8!2gAXpPQXB(*"M9(&h 9l +*#*S~@ ` W $X'"`)   +Sã 12 )+8p 2Hl븖T60`IZXTߌ`蠣WA@4\e Pp"X J"nc׳R XP` 4- 5 i Dl:( 0)P]I:i$+j@J])IRCzb)tNc5;J ntX׋#v%I";l`s~hha?hh q҆| (hX`ҠljT-Ӿ l 0 !Z&T,p^M~hPF!B지>3@2J%p$-&(b P P#   ld/5`6 9pW @X6N$* n `0 'oilB T*.%N>@ $`nl `Jؠy@ (  8$/5(" 쀌   @ T`o`7H50/;* @ ` @Lb p@( #DPz A0~ @`1Q_ fc@ =R nC `|n fn1#=@BexCjcn 0~ rLk  < 0Z) xqb  'p$)%l`Ig$D"( oW7`~(vz"Whs,I>pT-# }0L`V( y s,V$ x12 Z@ t@s"4h&lr.K.pb$p 1+Z\)S z``pc  bC` X*)f X+)B&dd@:## m@ @Z`0mb >`9ib % ;`cX4'eĀ mJ $G u,"E6#} ?, n0ts"ALf:ib# N&+%( '] @?35H@` !TEN@*l?4O+ J@="`t,N ( t  $" Qb $@L#@P.| Z P p@>` T h *qFHk L ``t#j`WK j< dL@:4F (bs4P $ B :mu`7& "Qvf` '@ ( `hbCe$& _\&T`\t\@L)x@'v" trdz,#R. }'LҲd"8H&t &~h *RQd tO  `H£j6ai8` @ p )ԍ"` Г`D>X(0"R  (r |`Ҁ7_B|@ \'Wp`? &@`SR8f@`HRX 8J>fZ%Fk) " ""lCh 7 ~@^pS p#x 8,2 dDqo&L>zm5`$4 @&}+p l >bumP`4 |q eC~` N \DT`@pc H&=TY% uT @ H;mv5Op`:@.` l_b T r@F ( @ ֤Fcv@ (  X@ v>(k`Ш d`>  ~v2ѶZC7B1AҢ "H%Ԁr}dx56 ʠ `|mTC h@|G/3P%`[ d &P ?@j zV`Q P& c2{z  2FS ` >`@ ` P$` ~ SIdlH}<  ` t2G3 j m% f Z]\ZW d@)nF}`8>rxTZW΀$,U $ p,`i*pt&` %H$pB d @ <@ @)b t2 "%3 #hf @ %F @n{*h8,?` 3)Q j3c v{5v\ .l@+xd1'@ 8$<" ܀@ 8P` j"$.@` ›"܀pL  z$d`PhLf &`S =U n` ҧ@"2&|@*$}  \ U# Pu>Bl@  =Mˀ  @L l@d;i`F ku& ZVx. 2fb$x`Li.,\bԳР nbF| 8@nv}w R5` ht>@` 8@؛h `< do|  ּTrʀu xt1\1 ;]#LzXO4 Lz@g # )  026Rft . :viH <j` Q"*0? Π  } mRq@ib #v `Pi ~+Es `zDe&`L@̂0. ) F\@ΗĀnLL. [J)=%t|l/6n6z΀6x ~z& @\.' VFo( "F <F@ d@ ?h)/9|,``z? >^?8ZIPcw X Bϟ/RR3͟Ԉ@3yf|dŅ?>t0p!7$2<ϔ,K~HٰC t0Fg@R 7P010bĂ\L \QAF 4q5+LPa,^qF :4tg.vTiCB =Ai(B\` APEVLBv?hIAM\P2a EpIM0},!h( a(PhCtTulS)L-D)Pb0C-O U2@ %! F^`a@TЋXPF2Q Dd)Є ! oT` ALGSh@r4] >? 3ф"́%ƷA 44 Z$ xG80 +41  J ? N1lXHyO@(iAXI%$0D3: !B ĽlqB܀F.gCsQPYi7;LIZ,D~ DE0BllPuP,{R%5K fh :0PHg%ŠB/FMIenHPǘpXw%E ctх >ta@n"Dp(YJtjIoXB $mQD l P[!5oLg}@0 '呄aD6C! iA|RN@?pL~ G @I@R ) ot. Ⅻ0[.dB :P H'$@ j0 2x D@#6 P@ Y0؁ ЮTMA bB*x =|TTLCIP;A>dH@PUUJ]BԆ!ocЀ+@g\@&A!+`MKT;0 BA  AT* v4A f`r NG,Rt 1 DC`.0!N\q]N 2҇41U4*9 1Wh`B@6C%? WC@ -hAk0l /dmł8!vDzIr ;P/J0 4!'CH7!`JOаjBOR$x&CIl`$`(!h+/L!(x ʞf?%B~}B@GA ڡӓƣ RGz+S J%y@p*ph? fh@  bA@!MN x$j聕k`f<:С_f:DxK x?:=2' CT} }h>@pȯ0!,<3!Ht`B8 @PPSϗak CЇ0,qF5`t:` '@  |@J͆ hܝ!q Ca_MY˒ pB !Ej  $$ uP^Pf@`? nRƒpB, WH"p;0M rb qKeRDx @:w?< A U O (ZEO?*t!6@j w2E/w`uNjhd]AOpwwRO``yIPi= n-mba@ >o6vb]l}0> TPPSw@ b@y,j`G@ [Zu`u.@Y qc{0u=0%Hvy@sV@R@`~d(6{0]l0cW@IZWuiF@r+7 `7X  y@xzX`>y0 7!P!0i]A/@$gߣOd?ncy>=TGY!M~!T65@0 J &B(7~ ^P K@%q)O 1sBlNp[:t1̶$7n5^x2!wRg_/4<:ER[pQOEp090_Np>S6dT fB 57 PvQ]u>pP@7XcIpXVj`J2@u0';cp {hI ")aVXWJ )w?pZr^U@*'J>H4bU05+~~PvA 8EL Mh v*[^P/eĵU`dFg #13L0Q]T LPm> x#Vz4Q-0!gW 4Pn0,aM`#Rz 0`.`Ґ@0,g`$,1 "$sT95יLw\Sx,]1P/0.q2a0aY7cHW y;F;B #l`B 0%s5"@)pʼ`,ZI 5 Q*ltR4sD0:00M! 4G`b q(!$0~Pj]ArZ:r`d.9g ;24hw|ǡd upZPZ4%_,2#s2#A`e4`S)*PWB9{Mw3p20a(s`d`nf DSM)A0?)/1"?![ )=]<隣w1P.6oc([=05S"~$ BA0,&\1elMtuL_` `#<`0 .p0aP30E];m8JS-S͐x`p@,AԛΆ@;pY F} `q`)`HB?@]!Á~wAYzt'0`0`x2]z)I'% x`?Y zP]@z2{`'1 .P,`(g0U%qa@_x CQ@qh>ȩ`E[MsҒ&.O3އ)F` _~7u 3=fBN2X`)5/(a'POW(K5Я)Qq>P;@4wVO=yn00I)a0`>&F9)VpV ='  T0:;v@d C1똯H GL0kEwm -2n)̷_+``,bq*bq. Y=qp4up3jT;)DCx H L1 РL*(mALoS8P)Uk"x?v= \c_0Âɐ50vZ H[k=6 ÇɏnHQ>J^|ՅWOx2h%wA1 "}P`+,x0a"#}}dS zCetXO5Yӥ3ޗ+]e@]F˓@&rNI@YqKmLr2;Nt e@S==Z$l7ٖg-|eNk2 ?dE]@a[:L.L'Dt dSӺP\S7b.&#b)([TՀ$EUq:#8is)[寚(:SO B$4FH(IR j"$+@:Cn%(5D8,e'A@ZTkY@LR*d„l"cvDsXN5-UEȃ%X3hM I [f,C࿨8 qز0E-*P;j\hPj88 pV #-Ҙ ^ēǓBB5I] n0{&%gbaDV4 pJ >dO">Y u{jd[^EE-՘P zZY6c@!|H'?U"LS-Hx|6$/d\}rQ (etHfiTcH٬e %N8LlAA*OBYŇ8v ɶbRjmk :6N56rna@ ''T>:`ail"}.!`A %ϐ'LOAM. . ZZJU>(AYai%>-VrY e-)x'%;?o.^@ŀ, ]R/ r);-K s%7..ǥ`IgA)D"MW{.Z1 zsp;%UvLbRYȥ%AA B5 ),g"Gj: zVǥҜ&.EZ4VE0_jTxĨv)aHC#I]~l, I (ىbk@@Yyr!+n5[){[@G!{*V)&D%%U)XWdY,M5ޢi)Jd_hګ3WJlQ= 0St氭 Kޗm%cַ<+,~{)3J 8t-RtVM jC,̓xJҸƵPUnE-0$0Yg8?E]lע8"h%DPB`$›[+\ _k弄^*gO遤LֳjT|0p&:*qe(L1d7 QxF| wk=2-ġo 4}2G)8S62FcQ67w M=-zemFfejb+YHBXtAŲx<9?QbF;8YQJtqIa3]&Qi3xZR^5)nKiгMQ07XaA,zۓ,Is w' P{ z`2YO_b*HnDQZً_! BQR'xrzR0*UA!("cB$0T{DqTQ/:1-Cv%S%ppj&n X,)H&y&Q &|uB4IH聚exi63-f;9Ldb{Aͅ"+*-Vs<1faUA:a~#]A!7D[i=&DSI }&Od0q;Roi R?ts&w9F69 BsCp&T@{ rPO1S?jKdA;UD]Ag;XXa&$R!sP̅#w[=3]Y=SQ{NDp*ȘFvd1.ZĎv;Q$QEh=#uc7iT@AI؟33]B$t?A57{V?pUė=.#0Lb*A0;zCw)&F^9q;PգHRL/F~aK&C#!TTai %%(a B+ fTW!nFҪ!]jDiu^ZYJ%@A|YYos:gBH/%9 (/*f*q[#1~!´`I8#RrA(T "D*)$#YSu? )H$~?pk''̃lbu&% %GIeWC~IS^ u{>P<QR[B"*BkiEU4!pgWR/$Y6r;*|0_$BҨ)$G 6CwkbI"sAmX6*R~kp2G5aYT`Rƹ r"Z` jtziC[̱ E$@r{]mbиtRf-pkx=Ac~8p7xx C1;qR+9oF1]twv$էFaŨ:f%%EӢD>rYʉ1z3}}'nrW~) s<٢6⯃Y2p1Ok@bt!yd+2DAR6[]1K7?qƉ;BM' ijDozYWz5lȵT'ŝp - Z~`$p-C7JJE&&Kp\RBiūD6a9H(\yD4qs`ȥFxu1CxHTxz~`+oZ|:OHP\?6q hUZl\&zk*iiv d!BT巯)Gc:E3β] ˑ=|%fq\d&͝xzIѴ2~y1f  ;+û_<9ϊazAё<"I/Ur?0ej:$*fpR{+( Ա"(:1 sֹl4pf 'F5k"WfrD;d"eN7H+xK{+yF"V,jLX4ՋqJgqΫS0rH̵yB;SE9Q# 'O' 0Ł7~*;W&߳,P f`n~%v2*F4b(ޅU-?Ƭ)ڍ:JG6M1"Bs""{7VO3(42Q D+DnEf 0sLh©K~)%AgfH|,Ϊ&"#IvR; s!z &_eVFrJn[ qSbd -"kr\!(]J6x&%] s~>=ޥ4%Bfw s=D8DlȢ}/jҪI1SJQr8Hnj1Ri15NT*FB*JסA;0Xx;.5\ŲjO^23`V wA1ZYhBv"ibhU*~+9˸@Ǫ1DŢ-U;qCB2koFx #+2?6j12QQYH[|]Y^6~m[sBeJ)eqC̥\zgF"#=:]n"! Z!g}in.*}&L(nT![xki*S&@/-nv7Qdx-pU^g"zɲ'?uP=S{5hLBXc %9b(GVC]gA `  P@ ,``E 0P` ND9с`b b,AG<@ɔE6ع ˃ YP2Q:85ĕ\@2.pY04;f@QR1qB[T ;.v*J,f`ajF~(PZ 1t r (/p dʷIJZۨΚ <.A0p ,F` H u @$¾<}';(`x+#  @*I((৽ o6m36zZ5rĆx"SB$(;p0<"@(l׋24pLK CӁېThEl+lLnnɊIK)Sʮ"V`-\ e|)[9 bȨʲ@d3Uݫ+{\K% "3$"P J + !m" omfipYtJLBuAJ@b# ".")4CR%SlЦ9$Fs4F8r^*"*Q$BebZR6Immk+0r,/*/@1›&~b-1VVzl:Ej" :6b! oK 9"CPd#le2ƲxKYpIN"F.FF7єX澍D^A*ih_viJj*1!A8F"N $9īipL Ћv{Hgb6Mi- Jl8#qjDb:@let<ƗS&(9IA eNT)ܢJ m9BYd',G}DawF:`&Kyq mȘԇ|)bēf%{j`R!֊xk00aRiJ PɩMC 0) *1RD2h"|x% 'Jt^.7CRTf!IɣkPr@";3!LZ!zCsd,jH@3D)= X&d(\ *X+ceDy.4}Br[ ȐS!KHΨH&+ kBhOf2QBtI$J]$ x2aٗR4k_s8=A^ UE1zH%}xzL?!n;PQvmf&pZ~RE2"*^SY=ĉSQBD"SU%=r0J@.Cl*şS@tC(( HI#@,T,a1  h cT=خc 3d IӘĠ3KC`9 !d ?c}2ډ20α5\/C ZT ,x2Ba3IR;xɮx7Bѹ)Ӝ i+h0)=8K 僝Ȫs !-(GQ!l KL )0!Ԭ}+VKC Sܕ}Y)* ;9(-ઁp˟7A !QP)Iq@٧ hKOr '#9Q#瀏ML)jxb ̍Īh hK ! *T;m{?!y9زY#)a8`/Q ؏p .t* 8"3hNt1xC$=<̍ԧ Oj1*I kTU v`gBMO,TMͮHA/Km#KOݘB]A9 Du!G`"Gr`vD\&A  Ճs J(BEi..G؍xlagԳ=U ۋHF} pV}gT?cp$MCor3D,T(Tٞ9mR1/Mtʭr6<j 2 _V*-0ׄXp Ptˈ7קݐO#UƵ(5ɒ YgL-:̒]$3ٞ8 9* [ƈ2Јd=P"(Nԉ8[Sxg `#먓T5!Qvȟa10ճ,(J p0 T Uݑ6Ճ'ղ<V>-19 8ܾH6 Sq2&ɝ]z9"2B2` 19ٹЉQ!_ً[FC" EHrL(U r v Q AL5!4~ =9ޯV ~ÇDλ!T+ s>pH2 Le0 ݙ0Z(7X\v!ACa "6n_m `a W<cѠ(رLΫ0qk= uL U= > ɐ:  $eO[T}!\Ы=5X,Ly\J0}y3A#!0J EԘl-PӲjĻIUb4К):QpcD0x.Pޒ81EH ?"ʣ%R бM(֥]ϑ[}9aO>Ԩ %Ѫ8m7"͝ <ʋ߀  G (?{kC[̑y3?ף WX<޶HWCY`Njᖞ`Y!=o ht+KI4C1RHbs]_501`}G띸`ƾZLы3^r*PUUdε^IVJ]r F|N_@X"$EM؉9u~VT@C7)]q%]W<-@H]E[U+Rxbb `ky6]תr8!NK"3V( %e8yI1 #|BGǘd?&!@ z{*Qlc"$a"Wc`9< Ff} %A2Ϡ47HwaҨ@| "$)nUt?RtɷdtUf(ƌ1(ԅ!d_S.-7 cxd~Qδ*F}9& t!Jq3#2A%L2-ƂOYT$fT Gg(Y =b9 @Vr?#MZ|cWgXJli1і0 D@ UfH; +{ Z1HLFfg3ɰtҡZE a GG F[tm$%idInK(9ϵs`CGCڸD22!ưSKls`\4N,r Ҵ, HбXN=`ig,p@tKB)%eKSh6̍7w#uȬS킣^cCa!0K89D.ASK1$QEH-$;{z7zS4RιECnA*\jWd(*DMڌ6L(ԥf*{5bLPhsj60\Blh#╗i9m+#5hrYYO"2~XǸlWTI3a~wRKQXgESH{i'YEf:MWYHlx:451b6 33>&  XS  RdIVVgȐ\jeX8Ͼ%~Ukn| FtBX#U!C؃gyꪌRܬhN`bI sldBZ%Xz ͽr|46,$t˓q) TcWr̝d6_(0&O<aDq *5 I; .&/5(K1HE GVDDZVIVӚtTF3伳KɄ|dbS,XMu_D<47 tk_g8G= MA$ԏC{ho,To#vH!INlT &ᑔx&92:1\`OUbɌQL y |a*:M&:kg54.# $jL"r15cbSm/Y$xCov^ &ќ:Dۘn&NqLkt` ߙ MhVLDwb֠0_ܜFFUF*HhO؆bE߄!}J4SU]tj`U-Sg,n0 ъ+r,dݳ4`0`] ШHNل@DDHDȤl爅v-}T A=҆!{0Ӕn r@tf|Z0 jIІR(*Ff@uJE\}mqI@sE+j` ǝ|xGF!o8 Q XN$!S4Ɖ-ld,nUSxE1a]\tǴ[qD`y#@"|=Yb^Y}mZ-G̿ z|E(!9?-Utϖh6T2\Jp:uIgzzH]R^JL1aEd )߰N4 \]Dt  [aS }%SEp`͇TpEPL} },x7,^ӕscA&x QIH9cنwT&awD}=OɉL n DNMZI(Ͱ%M 9]6yVLƑO$@=dEnAOPs|H]DDLXS]TNKt׌Ѥ! yBo8"ECD|,݋~sNX U |nh^|̨Ɖqr昙rGDPg ]kPhk!n3V(!H{UhE_c5= Hܾ&qt8lFHnɟz r r6.WŝG(Q@[C GEB\ؗwQTy')iq {D'ɟ@Y R vԅ\U_TlJ! L$Xy\=ߦdzSi|Pg^r߰iDJ[\[0ıIT0ȼF;ebhDD qJ!QfdtcL|v*i2ӍHe~ߘ`Xa&KEԂ[lZ %d .\\HԟɊ72۶R IMl4BKְENN@JD܂L|ɲ vQ@,DCG}}PLECeGH]\kUgHY{0ǥ48ktWbF6daE|V6ʄߜ;vJbƖC M  *GExLF0H2m\hSWGNq֊" Dąrp`e(N9 MTO*-JenÒ.J5E_ȓFNX@ն͒LFnKZڌփF(K0N4N!m6Ky鼆LՔBg`AAxV8Q>;BWLM)^J+nay@Glz]]׽m:}EZ\D:qh>r|Hbecϒ ˾*vM EwQԈ\*9D[h2CDZfnHL^ʐQRGpI&fd3{' VhǥIa $;EUcA<q^8 ,JM`Ufq"h$>E%u4n;b ڨyМt݉VP ?PEl{r^~ IA  oծ-^`…^ͷi Udž͗bM/R0[J@XTQHIXAф.UK▖`)aX ;MXE|R,LHO\ rMca2[HS2,p@)I!eyFHe({9"hVDBkV_|ь EQPeR/F"n;i!fВ: pKl؆Uk2anHg xPe@=i(ph+FtG'X8dA?ĥsH @ 8EA8ֹx1 RfOiHh% U0ާps*,lKcGL"9m׎;FmZ1w!r {lv2BǮhh6ciDZ-lHN50N\^J'%2cX\ e ƄC gF c-KF} M! )*_{Ia} vX *&2ȟxo{CP+l հmFgvD4X՘)G`͐Yt$I~gحI߆wx}CWnI0OFGgJ AFTyعc:PYxbqXwn+?FXJj21hm \V.%@,COba,)vĀnCʚ{P !G|9.+.ʶrgi"U͖"'nZEׅ8 ֥HS&'YN,hio)3FqlI^ nH-tM-W`>J! t]NHzZ{E1^B@G!HKĘYs\q \0LFVdZڔHqnPIrVTn ?37]V#E4whlFij"3lq5Z{\v@(PA$P@4x@ (>X"K"Y\&8PfO?d (0` P(̈OLt@ͦ;0m[k$`B&X V}&l @q ;n;0-@ΙXE"V μ7+-S>Z3,NܬǠCh* X 1bhT MjDCI"(IzA8rHάvb΀\+ "*2bK,k'jjbKg+HͻmP"՞2-T! HVZ-v4 #n& @OC K(C-UEB&ΫĔ=Jh:+FWnz2AmD82e bPm*>2Mļ m ZBߺk-cT,*UMb\dl"\(8qr6s8 y4d( MHGsd'C \dJz!,/UG꣹̲2K,?B0X 0ൈ;>񣑌@Gɀlw:p |+s0s `P 0z7MS0]1օJݝ|N[Fߦ,Bȕmځn'ZJXI㺕$FT;lcx,9 Mv'3ɉe9K'ee9Ze 3 ĘH!̺c03ˋ$x4qK " 0Dk/ITd%OYQ>D6P]BS ^x*Cd/N2:R# B N.P" 9C8 s#K],{Yيu(J9s:2OjK_6Dm">bUa%\RҼJ!{B*Q3͹Т>fޞh1Ids-,!P)_Ǖ!Sr\IdC.hRM/Z;mV-K0Lܱ j(Y$Y\A+͊CuLE* r+NDxD*TR֜>E9PJ"Us5pq@fC1R@Qq|BƄ *(9a*(l+)tNG^H s'΀ɩCL,ᑶBVEG:keܶ@*\ompdu){RH?$Um }:C>aUA{$V:mJ.65d+!@&_~W1QN䖒&iM[e=/ %PP"A%#"5hkޔ޲Ai*$}_)*%5g:0}G2&[ی1eYiNt#f3fUr^J+͑3Sb4qq2NvP!M y #aCQŔ65ʓRLLR/t{ƙXl449MDѓEQ " T§~ߺ;ŵ{" *˯ N]|Dlr-%`L$O]*RMנE.$*D*׍rDg" SڣCʡ ~Խ ՍV59v VG~`Dl?l*}YI(BQkM,8ґ`k#58z4gP>JI͉V@*!p@htA6%ڃw.)b(XH$LƘ pȃyʪBH(N&E?lB̊Qsc;(4 D"NL]Ɣ3XofcBe32fI΄h=:0'Dv}҂cȄpw<,a6C%" Ɋ[=r fe3clZ+3J8.c.gc只@h ˫0I xwE'̊+D'YRݬh(X"f9RIbnc,B?N e,X k+" z珰(U8ByJj 'ņH9 $Q$,!>CC#"bKvB{/F=fbbPl~o>DFgFl!.P8>*Gd1,(ch,B_#G8"=%>$Qk! mp,!`y*.Q"'HJ>p"@h]nCnm/Be#

Fr`D?l*KԊ, "NA(Aor"3Nd@NBx3Dc9 f@$ H"iIn+BB GnB9B98z+l~H 6#,.qB @@:K9nB0B2R]R_h!RXf0Q$W16f3q2}w ~’7&(pDLb֥F(HN+nJn'Gx|<-#Z nsb֎N 18#l~'9"8G& r@6"£LDC9BáBM7.4Ř"VEH5?>w(w .BMBc9{mG=즀87}d(b&錾X*MC&|rRDk/C-%#t,*cV`e7\)4b/JS?@@+F 2 @2BI~cJ-&D;G')"k,̤YO5,nJ20剅DTU4+x '%evLu0b<ڦ Bj3 0b6HH'#LC$;f>}O,VI_+'.&`-V6+v(@t3#h\Z3g-4I)n ^ vɱ>vG[k#Ct'-M85x9=A898 ;GIF89a  """$$$&&&(((***,,,...000222444666888:::<<<>>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JѣH*]ʴӧPJJիXjʵׯ`ÊKٳhӪ]˶۷pʝKݻx˷߿ LÈ+^Ɛ#KN3kYtMi8ͺkן-yMȟ0ͻo[,NG̾νw\Nǟ_Ͼ=˟q)Al@ & uWADXvAG$ه&"d(Š/h#a1 4#,z TLʅ~7X~ D%Vf)`RzY%lJGmE@~(!D'C  p9Th"PFj># GЁ騴hA 6~Q*k:ت@ꭤZي믚}X`Z+N *:kFز+]8̐Dd4"E~41A D n6%JǼAA&/D5%:G<#À|Wba,~K\`` @/V31c7Dsn 4`F$ÈEG]ϻ)=XӉ,`@5 ( 1i[ hv^|IvPUeH@\]j4hߐG~ GxA֑@ Ї^kd3Eec^Mp>.0X K`px`@ 2 C.?=K*Y+<"],<AG`.3-c7ԁ³$V t8Փz8RX10a_:EAYtN` B {Z -(7U`Ab&IS *260 V <SBcnp.r89g8*~"|0$P\oA˧~og{f$jDՊQ8s8~J8!R%Ž HYJpl qesX!zPpxɑ ag!>?Hw`-` 2|P{IrJdFn Jf)~FyDM,]r1AwqQ9~0Jɚ/p!GHxx7PjțMA4d QL A;G;cީ$rus(YEJq{&\fD ד_P0Y Q1ć Grg8cz: `lq"iX`q -Gs֕!`jqiTG0ӎUQ'y&lG+c`J6Xp0#NzgqT jsZuuq^A+*7s"1Hz (j1A[{Peʩőa$ 4 P|ī "a 1{zXkBpZ9`Hqd$" AA&qzop$I!;*mIg1WYٯ1Jw+J^=Wfpð6o9(4"[(R!KueQLpp^+ 7{9;(?;ODFk!u`AO{d0Qp&^{!tppq`ߤ48>@vɷ\UNJ~q*!@_zmp$DxH zc|PQ&^p/;uJ@yNs;1p͂[NIXI@4:{B>*PI&g+Ї1A>v]Ej䵬/ke !ڵфЌ:'3 [oz(*އ!o0,qp$3\5,7L&;c!q;@HĂX۶O~)W=  Q Έ"%y\h`M`do{\r3slQ iGt" p$]^uU_ a< & ! ` ,m h A3hcp܂5.ptP٣[RN-v ;oN{1})a"1ɢeA+8$a5-sH~ߚ=o YI&-?G s%QF͝!B>=PsQ]#SC'g&-Zޱ$c.VR 6~JR^ ~:5C#vm>#aA*RH`Ɲ>}fb>u>X !haAV\Av.hM ˓ze(AZ,pN"XA+ Q<vк־NގN$1QQ10'Q@Inw` <0R Z)A _ ;`;])a-%im`W-_a_5P&q2#p` =~ 7'@;;EOyФs`0JuP# W=&$![!;iOζݨc=H%Ѝг!UW+sH'$o _:ZE9"xO=SyIXb{.N0Oy+OU)&nƨO9g(?X2-9m64G@ DH $QD``E  `BOI-]SL5męSN $a``XԉZ0C)4D`#Xe͞EVڦ$ %H3T`:ITSZvJHwhzy`Î}?Ydi%CYm(m \V4g0[lڵmcByi g<gl^Ц&0_Ǟ]A&@RI Mn<0Ԑ~/;#ƪ@=rO?OЀ&C?M *0jJrHѽҺcXD2ȩ! * Ψj(?t`(.jjI!3L1-(Jrɩlh,>j`H2iI%TSˀ (9ƒKz`+T Ȣ#Ta%vT 'z5'Ǣ[?ĵ/&ba_b7ܱRm`pbIc?Pd*PWf`/ Р!*1J 4=YfsBU;$ 1jls >h",7`v,T ޛp?pnfq`h9Ț֠rtwgOt R=(ˢc0vv2s.x!rr(+  J@cX` L`h`d?!+ O~9=!ALp@ `EH4/=?4H C `|4 2Ї?I|)QRBt `d(_2`ы_d zx#",*MVGD 4\om0$FAɲ2aw{6q XgBd3 m02IYeo-@ B?M:lC\w ޞތ6R'z8[.lX4\!-'dx˂'p\ NLJ?Fv~FvLp[Og$s)a0jˇ?y8RkB`szڑ"ĀO=e*DC- !]>xQ9:ܓK&!zrM6CzBMxDv;Cr6Yﮣ8YRӄ \;{|~"gKfN[l&_aH {[ w)g2GPv˻W%e~e' ;p=2* {<>ʒ I <&S*x? / >K @~*%" Qr9+;AA;8?`=Ui$ܽ<x=A$A#밃8:C#}')9)" 䐒q Ċ Ċz'8ADӨ(xy(;K<8AC"HO >  *#Ś ;& {6XT;><  cʐx1 APDsFƛPhZ? pBiWLG[Gp0AG xJR=Z$9 H# `I >8>584 A:I~=!G:-6XQIɊȧ',J ˜/X:hQ*z~JJ" ʸ?q$8 ? HÖhД$Ʒ' ؊86H!k+'rLaDvLOJG +:L!Ⴛ8Hw:a IɤxtM 1L0iw>ؗMĺ 5$1Gي- pl`Y[0hLq9 N0"XtM 9P\ 1/q+ ™"OX!RO΄8:/1K)t2 Њ5!l ;>h:( 0-ꀝ?8`u, %8@і&Q$---JpR Lد۰zS1k8 .8K# JH8E ހi1 9A1RjHH> QXE ;ڀ"8*@BK-M=ԒQ S= tURqF ȂUUH_]J 2V088 V i]<]-'VVp}QA5،s?渀{eW^@UDoRD [+a@ Xd(DžW>o2{͎]t bn).GEY?Rٗ{YՉYXӠUYba2h?ʀB]*Zhʤ=Sh7 X9SEZ0jشm{Ve9 PXb!Vؖ8e&[0RQ- YLl!` 40-4>`+7'܎Xϛ@9Kʎ)Pǀϴ-)9hXe0 &1S-ݼ)XT\e9͎8Tm^^ߓ%_0 hZX? bу`xXP͈>" $^0ύ :oA`  0N90! /XahapHf=# 0@1 8S}Tж;=]؂&~o)С Ғ$ -!.Aܘ)xHȃr:#X@;b@I"`%=>~B%d8@혵ddZ[.PlaO45?0eHeXa Wސ1#@1h8DNeib dp(e,)찃9]X?X[-h$Lkpbo&`6e, pۀVf.x h0۵g7n  ƉpgX(h址yIِgpgqhMi2=0",h ,F 8pEeI0{ 9hT;xdvjS! ny 3=0$25L5G#:[u:%]^o`6 k/<՜iPf8~lb(hE3+lbi <ySX!:Z;0ؖW J*߈@ߺm홀! O[aZ ǵh讎h;ؕ,׈0Sm7co ?Xo2)o_)/9C6o+X x"uY T?ئaR9%. ʨ(πr8, "8K̮ 6)3exoݏ)<6 _a54#؀&䆈3(0w+Pʥ3 DWP;H'D_ttSK׮t<9JO POrG 63J7p Q?>Xd(gR#3090#8:vKv?QnPkncB-mڗP^د3Pkh ܝ2H]9 HKP? 1h6#]p$" *97yw?Z?wH7p-/3 ܑE <\6n cm&k'@ `*p pgOx'7{ 9`{!8{9(`{>lj@swaNWir?08XHG3 @v xQ-*}/[tǑc?yaZH A,7%h\uPWOXTAA0qϤo)"l34\+ذbǒ-k6%H<|YCJ|L,$d >g}%(Q}d,CN1(3ТGn@.̂~Sz1 :DB4RBn  n:O+]b <ퟗCR[E0 X]?Xa]@@,B~X8!ZwJIE@GA ޅ@EoD%QFD Mx$I*yPIy1VkDb{-PIƋyXvl|CgPHЂ ]@_[ :(uXDT&"!j !)C~iA}|:*@pX1~@ JDR1P6 zX8XaBm0`^:-_)z[DR f>$ N B kxp&D?"N4lƋ:t@ЁeY>f $G2$:f@aB,!bH*@ⓒr nQ!еGHbB@Ԥ!QH@HrPk$.Pm  Y1 }2ֆSDSA k&6xy:DrӉ4 ~t>8C 08 ?~6 9IJ1,M\(XZ<4,1`u\:."@%P+Y% ԙiXL*U):`AM|DN#VAPFȔ'Q`U`}*U BHʪtX wLYDڑ/dA !`R"  mf1:h,d! ~8y,QHT;mZ 27inbur^>Bb@CUA{%hw#"E T"ax2w$|ANLCHP83$#CLj}\BX#XYHx*(0k4,83 ` 'CT2pvvf Be" `el/s H>p!\Z܁@2m!$WV?c`XAH *i5X8.ڎ= W(Y&6% BD;环# \jbM!QLp@8 Gx*_ fd|w̳C`3~Q{-+0 ފ,B2 HgfQǒK`5/ :r/݀5@čixJGvãN-#A$. (>{q!n7h ".z <6W%ҐC['OB\`Ch/J2y0 HJ͓ (< Bk(}Jp 2@}JBQ=#)P66.5`@,\v!#UnO=&X! !`# Xvy(D 0p9$Nh@ YFHADKHD4YPP`Fa=_Ȧ<@}NCA PhFܝPA_H@*IJ>F;5D hAFNaCA (n$ܽnaPF\@m_AlYDZ0 Q BD VG`HP̭AI TWj A@Q ȁ$ **A b+CYeDC"A@͑oA AD@u#) HTA@AAMZ@0L@GQp1@"> 5V!b+<4@T 0RT(@pЁLk\tA?ccFF!LEL@HF(dl(D~MLHC$EN_p!*AHV<5 `]CH @:ڋ &2]"[ٸ[SbDD!*D _XMfBA@h:@ t隴EMA苞iG0Z_A@e|B\@DDiAwPA8X[E!u^\D'( ( d ^J @ً^ !*G0U 8TD @]^1vhHl4=)A0U \jX @OE$aP  T@ET@ lCDM*۩lH\ldRJNyD`WD,tUx N \ځm6č&B`sЏ&EAV-x0D@Jm Ҙl&T  -niPOQf@੽ĀAD4n&Oyȅ+A HTiBA@B\fk  >t*pfuh<}@g0M0,]FiB 0aLJU~yFloBAlo ȑdAt6YHoGS)jCU[AO%YT Z\0hD@TnB()D!qMVee(J"Hk^00(R4Zn:7J9DH Åk#>l8I2θ`@ PbP3v: A6Yd?#"[m-*`Ȃ\x܋U_54w'Z{51dhAj/W$] `ዊ([ E|Zfn p?ͶmDX,2{":( IE錺V fc9@D"(*K7E&BBaH X%.ȏpT驗 V%iZ?(/$ pzzE@݅:4BS:3TN$$HA /)F?'6,„ U`H*zԂ AHn"{;@@[+!LPYAPaizp,@<eRp/1HF0nA 'R0XH$HHH3TWVh|? <-~>4$ EAу_?pe5iQ.$9x$p&ؠ=@(aH'@ g"%mX$yP sF!~(B2`V.&׀LOOpb$ ' ;`;`a(?pEɤ rN"0HG ` F艀dQCCm LY`@@Ff3 O8LLhM P0dH0@$G@lđ8MuQpaCH\n[vPʐeB~1\HgL&Ԇt8XBU !\Fؓ BY $X%.a(c(k( !>CaB#`@U4!奈Tmï,, 題L])t$i+(@zK@]㲂Br0PdcEW뼶HYt8Ù 0ֶ,D¸5HBxe!BL (@@'5#y '(HV2%Pk2F0d m`qtPc*!$w&8 7FsF@d$ (CH <`ՏLY"lI&;(`˕1e"4vpcQ`1& HϚ^M 0H:au(J5 pM@-*S$'R vgH`3@'(jP@ V DR+El'l N8ܩ,SXBZpAHt ΅Hr©F@4;ofQU {h(+ Fa>N[p _ 1P>Ave"`HWMҳD+p2 l{(6̖҅S`XCr'xN vExtcG$ I"'xOrtE7p(!ҩ=k !l' "!h @>Hˣ&HLXÍ8 At3D-j (@5GziD -b=k5Rw(z5 (yi`ȶbKyDM(  `Ȍ[$>`F  DdL f8 Z pVF ,(; @tO ~@p D"Pk1 B"BF"g 0 jZ P B : ( jF J4 F!&(i$^K$l a(@J h l4 `[ > @&jB.@2G|`4Ƞ.B`BPs H` ȠBDj$ @^2#p$LI_܀D\@$Z<6@ "D6uB [&`yH 5%$`N9HP5 %٠;I1&ROBB )@.v(t=t>U Ԁ lAIp` R@B"2  Z`!$0DI 2 (V &B@>p4Guv4G-$G%@ ~tGN"D> p&TBp" Ψ_N5 B @D*K^!4$`p@ ďJb- Z@pSl R@LRqDJEMz`CT@" *U[ T3#mU)T"@+U%.עLWU@NG4Kې$:`"$8@TbQ " zu Vm".1U@X +Vc5DPEb @BB\RIW+`cu   yE6$Ul $ FT5VnxB", "JGTV'. @uT TvfUV`fU 4@u cSEdhu2NcJd߀YI B$h@ej`j߀nslՖj= @F^" D3_| :1ӄK+ pvhV %$.%*CHDj// fhFo`f"JV oGXSu7ăX W66x%Є ֯(@j 7@ z7(:(w5 haYCL@ r@jc@ x$_z6'ĠkG   z FZҷ2@ z?((xM)zܷʀZ]bZ:7) `F?L S `6Et @@w'XxXnBI$m4) <&wWRm 1om+؋x{)#j@W+V Pc/&d`gE'dH"@q! 8] XIؐ"R@F @ 7(I4\@ p8K .=8iT**"8BsWTxL`? ӳ)# 0.qTRď2ʹTzi3 :i :rD@IBp@J ΀   `t YK 3MٞMBT^P"`bB\dࠕ_)8" .jX.;0k( @QV` <6@"@@M c$` J~Dy$8CDm Z_9(W "c2R 2 [$h\ $> ZD D*l(Cb "CT-z B "cHe6[XB4  X "@F & LZ_%b "㮅Mq!ʠ `&$&@`1"zjOiYv!8ZY \ T:@ ~CdB~`,,5" ?Gb#~% D8~y)b >58!l⡐SjH (G >|E#@ @ƍ8D["<")b}zE຋>.ɁNCB ³-XV$pJ [8 bj 2yL*2%`4  )bƸ2 $'?N:EbJB[pdͭfR r"Nr Z"R-&BGn (l$6IZu G D Wv֭ՑD I*)B̧۰z[׹d ~I I G<$z`M@`*й)EB\"  ``!:@TЀ{X% ZU^5-`o Xb @T\ҼRfI/`<dC. @KX@ J. Z#&`C  p$<0h> q F:~/[Xh@J;O)T 84TD%J%hE> X% @JE7_;@ @b.E-  ; +~d;$ؽ $&|0 Gh e  C#Cb (Th " 4,j q,f@8K&  :fI,?eIHa8 0$kڼ3C9)$HXʒ%@VIΆ%qpzBSh 8F^8A P@#S 8 >863N .j*) 4 p(FUpl@u|lgk,D1c`thC)w8$.~h)K]Z`;ʊe~aXQO QT-*gi0: \A !EE lGH(F_oGxUH&fA -DRA8@%e{Gc6ވc:s̡JnLV @5R68ԇl @9TlАkqH!  PT~A8RH~h&1߹RD-Q 0(uKeٴ!6h$ îVԋ:

'0_Gz50*v`䰀qP?!A1HLhdځ 0nD0(=*3TpsLf4ǀ0:[y@׀;ʽ'DAvy͡'`E=t DzCE{?o:jU0h. +>@"ޭpʵLp@mXd\ wB [ 'krpNFs]mBENx0@*&`D{X a'|wP`pC:E!VTO{0g}pr71GB18YPN`APlHh5 N_#Va`0er@FZ0"b~OGuB}(b_Mnx#``n >7M,04txfxPYa#GZ11p7h*(x.Mo5AF%C(a *lhz0¨wUUN!шZMk Ј3Xp:ЈR67 C4(is1EF tSxv0@3z'YssU9b@#5j00m9gDu{Psp* pX*CL6i ĕ_ ' @G%<]@/ь@FqYX6[v)E`Y B(xD\)p*:go b` @'y@t(@M\]DAkFaH@0Rk@.p*` jVFGT0Y ҙWqӉY@<%Pxr$'RPy5%r*8Yi)"މ`2pgSqt9b@<ٙaXi[Wc#ө|Ba ҩgjc Y!|Z0P%CIG4@#  VBp_O 0xrcNaPmY<@ sԡI>CA:! h!uSџIXy*s`!sKS0w0"ԒT)%,Wsd=ŏ!`@3ꪁ A3en6Wj>WAQA3@ꨙaLTwI#R꺉1t%T;5_9 rT/&to=r ^p;jT jdź#{/@ G1 ,+GBR0@F")5@KZp hpu@[t0_khP0k\˵R_$q 4@FSQ&V 7GKkgb詶[ 0#n@D @/ih_v@k " A`YH 1dP{4/ddC 4;GP sdNԘ<}`< K#4x8GЂl 1kPuy~{&G l.T>Q;Ip "M G࿳#&GGP`V>Yp's5 1Gv8[ipv8TAJ70:Gg qϑO v oPY\%*_5lziPP#LJܥ`,_ Z#;MƚP=^|@ś8U@D^a(sY0?PU@+B<>>-0q@Z\UPhFoU , <`<5r@> L9lHpc#QQˆA$vqbR4:޲̚,wrǹ< ښbL@f-   \bsFryi}]?M#\.YK#vVM}2R|O;a2 6 WXqF*o1!j1lYo :!jcbiUpEճ&xtp- }pե Wpu{ўS7B]XM-Ss @mn075- }^p<ɭ˝/Jd50%P \gJPZ54PM ):r0PF ;SR|ifbU Z&譥=up3zJmptJ0U_PR4=aPQ2 I,X pO]uǂxY ["" pއISep<pgg&~a~\PenHfZ5q1bnweQ?n聎YB nEpnz\nnHw.[ { kSG ٬_H0 \LlWq~nnPJ aNaGN`gp<P=pmzbyPUP&RT `Yn:o`[=%8#+ /1r< p Ϟ "F+J*/"8_T]Y"p  qT>O >1O=y#)P3O"PA~#'^81 #`8"5b"A"PJSN@68~/WX XCW??`?tv``s:i3tM[]u .a ?c[P p 14c g0Q## X`? .d?|~<\ nؑc!EXI)UdK/ M9urg! |sM)#:=6B&!Ę[pPÙ?Ks, FLqb&]yW\!O,|(c$vn6H 4CYdcԩUNF4dϦmܹS쎄/1"0pDk(0@j O&8zCsx 40< e[6@ o+h؈:!7 `%HC(d@;L  C1K4D8c 68,(ԠhQ< XbP P\?XcsuW^ Hs7VDah^wCZ9P(n[nkE0 `V``q= 4pЗm{h = npw 7Z 0U }v( p) YkEih!Zve[NM +btMYwg#bg+` \Kcag7;⁦7hi+$ȄR4l Ʉ9| m5iʌY*h:aW2pp.K;<لjC}tEBgbNtc|vk7)4=qTH f0#vIB#8IoH]|}W6 h}78J60`@ $P d`-`I-x,fPB@A"$L0q\k#` Pk{ 4zAp!!5nBNNX v \ALX +>4/q<8EcQL $.n$o$Q y fQC x )8G=frPQ)Y"7# @BڤCFQ\I*R!Y$vpLd ,81˲2P y s `Rv0( &(,'&ZpB=UZ g?wPtTvM`rH#S% c9 XA`Ks'XxBQ,!MPi`= 鉚>DGGQ2EjS:YP(Sa‡:`F0 lc}+j7!Е?p6Zq k_YNLC@U`5XKeUFV}&7ٗldM/ -0ΞZp2 mɍ``AT8Gْ%nqar.Ÿ0 CKU MdbZƀ@A:8׮8)s 70u#V>sobezqm 'X!AP5Akpi` A@-P8kǶ =\Džjx|ߡ!q}"%2j:eY`rA;%|[f0i 85HTC@s|g>AaePs%&6ox_@k/IoX^YM`d|mLp#X`P2Wm(gM>pV%P~J n9\84zӛ.\ ??Np*(OG+ OG#+P-@OQO08 PdP$$BHC-*$ 0 b ] H#&%P_5`^ƠxY B/j#;8s\"I}J'CzۡV.Ѐ9%|x )7P0 @_9! Zu+Ȝ2>>,@|?*8+;вk>ì8 8:D9؃>?()('X:@ 3 " `!B)H$P)`h!D+S(˃S`JB3Bj0P-@0`9,5*.PŠ(4$,ܰ!@dc+3 922DK@%xX: S $"hS)P%$ HE?E*؁7x*QL/H -%K(K/xH9xpn JJ$')( P (XTTL+hyEO|āЃ̸8THf)Ex3ȉ$-8c(=6@x(p3h=?Ѓ3(  ɣrԀ C0`HC*= X hG|ɞ̴L;Ljb Ȁ.@ԋ>.).X6<.h$ DN 8%.`h=r7!48.xs H.̼LO ǝ(2@O Ԉ'L&Dtp9h > h8 1 S* ҃ %7QaQ ؂*ͻ -'Q(Q7Q;` P{ Q) N(ǔ`(RopA15 MQ8h6ō08m02 3 WP>/05`=ӂ0? Ð< ,0B 0Su6Ue35D@?AFP `P֐(Ύ.HQ 2ymOyȀ{-X.)`4XYՃYHJG-h @Z;H1"( H?#P+IXЀXP4 =0'h>ȃK?4?8< Hmбَ  7ʕ4x֍0P< (4pň ?H(7?68* Z=(h\x<`38Z](ێ%̓=؃Ѕږ=[x<Ƶ$2j ]xt\ݭ8 hX+ЅH_0YXC<0-=!,`=p iGX/-Y& ߝ;>@# aF0H`%(фx>$ U5^420:pc /U2aaa;0с#PDY-E\J}1 H7k-P%ؖ0tliʮ콠Й @ Iߑȁ/% ȁ<# ܛЀ4)PH-* 8恅HY1.00`7@(pH?#؀F<ȁئ5T.Pm#l#Pio7|l/p6K{%X Pp8?P8b=x5 >ɀ Pn  &1 ? 0<)`1+P/6!!f H9d7 x"$۠MB  2"(j6p?s^qfb``;z,=RʂjS4)L)x#G"e$p+L- H 8vBG _--y& W9KނLׄ7" ,/ 1tr/w]i"򇘙C 1n ,H&q" i]F`)5cjZ!8=ejpn"&. }83}WM& 8;Xc !n%?Xoo&@)假jos?zZ](Ƙ~-),h˓2Ѐ,_Gm~vf0o"b;"`)`X,/)oG3S``xx? '7?}ו>eL o}C,؀ ދ" ؃ 0P6}0+ 0Ӂ'0r0,(⟃OǪ  0$Y_a 14`04` A'ذI?:@:H&DH` B=!# &5&$8 3ǚ6YF-o *t(ѢF"Mt)ӦNB*u*ժVC `;D  ydOC`A`$q }#C_ Od !CHXΓǝ% G 8„T/Py80::;yeh XBa}ogc&w޿/~<ϣIVnYN`@bA |8^pA =%}}CMQ4DMgTXD1!!ec )CoܤFP'YPNP22buQXy;87 uD BAA{k٦ojMJsh`P%Uo~80Awjliw)~i @tBّʚ *4 5qhF Q CAP@wQDZ.`÷ ñvԤ9h\0PpdpT 18QEU!{@ dCqP p>C @ Q%@*LCl@~JC %Es5sK 0cKBV|GGtP_0P 9tOћ$4* #`&&Ԅ _ 1P i8 |f )^b'*Ta 4f  [*{=P{9KhDG(2@ ?dE3 Ce' @0Y֔>dA ? F@ ;b@*R|(p2}8lFIΡ~f aSâ A,V#wP 2lC.5 (P}o5P`J&6 !G_Ap1(p<e7' 4X yQ$z>" A m8 jЃ\(CPLem~ TCTMfT0C@ 8A ੔9ht) ;h4@N5!@*h`< H C@^ BjZ 2*WU! @#x=:ݠ`ŏ_tЀ \ <k>vP :*!r(b l0Ђ -h XЬ )`_-o{>aqG,PqY ӂ@$]/ &jCY y;0#"8 ^0Qv (pȃ7""+! @ :%$1T$t \zHg!`E5PW #rL! HFY 2kNWYX(bf=A H{+ g0U֐Rؼ"dy5@`A`B @zԫnu&CBϷ) z@ ~ e?C[NJ|w0f6:0 ".dEv04撟<$su;x@Rχ \40 .F^9 2' e|B0{s v>Oz  Q0/ ߁ MrЯm:DGQ<@\H"Q>4@XxSCuT+QOKUÍL1xSAl#77]7mA }'p; DxްM Tc; .VKH@#@nMh$fLTvjjk tA@qҶ%vɊZLFOvpCh\t P@0ws77ڄāɢy@_! mm @<@ (@A_(gPALV}ۀx3V@V S$h`E0F @ӾWŒI@w% q5@ \pIx >CAJ, 4M|$Q $GAwfHAxO$h)Rp, Aо19CAT\A̘Ch@`dN00\T#"AE$@ |O$AZ q_QP,l  2@wHATj |C(P~H@Aځ`D08Ԁ٦{`@ڵk9Q\(roA X$G,2K0(T'\X8̛ho@Mlt YX\sAyU趋|/u{Qp-]ȷ#A`A9 8ƸXAPjJ@UT@ж:0)h {l@)C}vAi@xPZ@K@t5@ hPCLC@{PzC0RpAV,$I@>@` %+_H;T$ :ma u_A< lEȁ A@(@@DF`i͟=y@MD9 X `@4rt>yX004%bD:nb O9&y`fR>5` PdZ$zkV[vlXcɖ5{mZrLL V%{o޲jfv a!/t,@ě?c(NHPQ <30 d??~kB[ }M~'aFM`ⷞM~|xɗ7=>"~2>s $I?~)Q8 >r`:Z?x+:b6* i7LU$-` Xeՠڜcx$j%b ds5L#\[@"pC5ݖn-/+"Zzo%o+1H}J*m(F?!Za8ֈb-c d(, yC?TZGJ6PlaLip1HH@(!,k0V@PC $l ?tN0|D'>xzCgq-`a8x82 ih` <EHw|08&Ne5x@ a<"$fbJ:iX=@JS~ыYaþl W˂e ax؅?!]S0Yx#d 0FGv "3xQFtN`P -u7 D P" @0ņuA ",` ☕)@`4B"-؁XM+4J@Z9թXpxa%`0,p*$H@a 'ȖGĠA'`G0X5 zB <0t <,[0LHqLpPX𷟐jIJ~?HlV0T,@ UӞm'`Pv Mn:a_P⪁8CvRmg:$h!!ȦG j4 Ƀ xĀ |& h:՗ A6p `ؐ70Q"Ya ׹εp$P O@ h kD?@u0ri=Ը,F`}k Ap0@aw=P.S'' 6!h18Tg80jOHhB ,7u0Z' 'Eґ*iH#eAؐ-qxDeSx|&#[A pS! &0乂 t&4Sj0xpj /8~`N'Z2^h ŕ@: L0]aOx .r8 ZE3hr/p,?p`_:O ;@ ѱ n `GKpQ Chf萁hd A ,zFp;`*R0cn9!L& v ;.?xK lu&ܡ]ҀQ)_y- (>d`TjB |tY+mYԦ@GT:a 3Q&/OB@E:O mT0ghVFHA~$BP '$6{{\. ǒ~2-g[z2$?<loʳi  TJ@" (#hR.d#(0^@ r΀b+רʀt("FS`;PK@|'P` 1˳j  b>(@&. *k*` pHq2p$*i; -  (O * B2L4h' Ȝ@H4,؀\+'@݄KyD>El BJ bl#ZpHrw6@ ƫǰH@P@ *`Ғ`ԀXr X~֜TQ5/ UƱ $I< H'd `Zo RT 6`T:W#pj F`k~`BBҌe$jάb `x 2' \R[D N,8 C<4: N,&@ < f 󖀉Zf@[Q-` jƅJ` f#`` `@?G#;YHؓ b<" hw ƀ C6`0Р#57h`&ࡨ#GVF'Jg\ rm F # (1 Ӝb `D"@  Af@; dΠwpB @ 6@9P`w H@xTU @# ,^J-# ~jZvw |bf̬P@ P@l4 2" 1`ژ. H A:83Q~ |r к::`Lf`: P PUd`{1@Z+ 04|i@Fzr sD@0-h} vೣ8   rkD$֒ < r` `ۢCr ` lF Z`Lr8p@ hx J2gI&)Ȃ",tfrv{`G:,]H8 怶'$` |8ǺC\xH`( h(8 : c  j\@,IFm :s< 8, JM: " : : L f #ʠ'nGϜʦ'J0l#b@N `r v,ƉZ `c&`'\<@G M '`Pѓv@*}S= f.8VOK & <M!`tF#: ux v@lp^e-ob ` #rx Z &`CB `@3 @݋#?Md`D &#ܠ @~^@hWݦ#(&d`nϠ Xn6_dج-|2`'AA` ܄ מC*،d@0Y D`*  `TX@ F 9[ # *AwðÇ~nHЦL wQE NɁ@A*w`HP2XCݠA]/ aa/w ,rCsPAu9 Q@+AŶ*p0?|l aTTDr%*PP Da 14֥A+5lp%G0<@&J<`x% Đ8PEnvpH \a< pG/dq@6aq ay 9 Q[Dܼ= :C5d0EmA1<\LCQ MWARL1N0SH8 ,KPxRaA2#A ? s@vJP' IHBʶ\ B@jPLBb_ gHZ%7 6 @3`dOC0k3x'hPlW`@,'"/nxģ6d> (40D !PⰇ@Z`$!. B/4Cn6epVI@򕰌P|pA ^Rp5 `@H C@dq@ J#$Yz @ R[@Ӆ`#4[#![@]83@MB44Dx m(`,\~J3':x08]:E8h$E[#X0X` Khe0Xjc<8[UB(``҂hpV], mpp:Hu8nP:l)s:=5 Ȍ\'Kʲ0cmL ,KҚV ig @s5LL֐8!8@\.Mnrq:Z-AG)9H0A x>:$H@ :|K_.  H1LOj!C6'Lax&oNG>١< (F1+?7\RR0x ` .O`)YXa~ű+]M쐧LAr1St'VOz|K 64$E~Ipe$X LB cҁi&wPA'I7iq¹HM`&tPiH=eM@Ӌ C_wD} #0귳!n Ct!|9 7p'iݽvmP X]D``wJO O}?ANIY0QmGq@N.nکqHva+(`1 3mC` zSNi C&\6.򹎒$4XGs À+` %$IE8Q~()j0 .hN< g#xHu/І pQmr{&" [+hX2x@L Ɵv/ zֻ*Uy2ˠ-8A#QPtO>Sf3;9\R; i~ 8u`="1X Eue@!̟D?(apCڰKq A3PV"[aKe1:F!\E0_`r#Q.@[!Pc>`Q@  {-P\1|`"jX$ Z.'"tQ(s2@t*0{ A{?55AWb/Fv%,X`~hNkC ps/jȆ p7-tPE0#e39Jx8CV*Pg3ndsp-| be`V@dQh1Vz@6p]a.Qv #r޵fXu" HG fp~#; _%P2_D@x 0zbC pWj!6'@g]oe".P,x2  PXplxu"#!:5"V%F-abjVPB0j"P1RAW@t3/piA6vv NY3 Aj kQv a r Bn6MM 2 xHy u!FP$dOJ ph11H 5$fƚy3A $h́erpč&x03 +Tw@36^5)boQ1 P=Wq0&CMמQQ5uBCӢL0:D~ڡ7VO^@yM7pDp,z$w@ϣ,ZCJڣT#+`^=B2T`H AMPhCXJ "H }[sp-s!RP crYZ1aJ3/%><dz-wlFA, Q=>vcIo 1Iu6`Fvj-_fڪꀐnDfxT? Gw{hC"ЫaE@HQD^DyGD/*64`J FQ^f~@oVEJ CآpxHS`J*6QyAw_ &p #'v Nq7uD[#`$0 D[*0i*z!52{@I``.hB+K]H23wF1/'YR80BLCF@^S0S'\ 3{ɵr?}49[Xw@Y"ztc 0/zOmVhU9;Ch}#pizQ"r] p ;spm4$E@79"Ic+{9ЁPÏB\Wpؼ]A_;  4 ^ܫ?`ϻ]'vI/껾쫾ٽNI0_Y`߸=Up Y!$'\nmpwwhb )L"$\[GOO= po%b W}'?|ևN\au-T\arPPU^_`Rd\ezeƸe ppLdq\Ǔ5]gz.N^Zpp˹.V@ǽ>^~Ȟʾ<;GIF89a  """$$$&&&(((***,,,...000222444666888:::<<<>>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H*\ȰÇ#JHŋ3jȱǏ CIɓ(3Iɲ˗"aḮɳIi| J"/E*]j2Ji Tju“`ÎW'a K8_qtxG، X9l&@mH$b^IxL X2TJ08paI0@ bFf!^ !I0Eˡ & LFl:a䐳]9=a 4@YZ&1&J%fpІ]'AIaGt.LĒP!Iu $E:\'a'x!П҄ga,4$Aq1i\@? ɔ *=i)12&X|AO(:P ҋ3ˆ[A#eqAn>8x5!%T# D@m[ N_"J AA4haP)Q\G8HE~:y\T F\){@w|`'\12XZ@' !PbvPp2GNl=L3<вAP -"uMP y}A }QAA;0e A'4͵;ȊxK0^P w!y.$nt`4B&={d@)&iA%HkPJ0,@kdoAc`'n \ ;LH{t^B[Asx42&$dA xbȔ #OX/X6h w ~L%$ aAeu B \H:`2!0<,3H"X'Xa!KAހp#h o8(x Y|FxP1DHP u `b]#[D /Gx`viBTෂ4dD3+I&D8Ai"0‰hSA4Č| .@2!,(@ˊ$m8&L` 2Cʆ%S5d VFl ![j:߀!P]H Xp"P@; †ش{T5R`u}56s}8@$ )dD%P Lepu@==BdVU"n 3@ ؅T Œ*bfbA_ (\ ] zNd9  Mn"X5^!`Ep4n{BJ]!g. d5Gav!'CPJf:a.Xk 6>i%)D^[uV!bh(B ZmBNH|aPi…LX@l%Ƒ FK/t7#Mnx|{1`@$r!6H 6,!_D XP{v$/8Ah5ClT~1PdF>3 'X.::`|=PA8B,` D>BDoJ,#a 0Ao[@p$ ~ȁv%䏀a+odu !/BNT$ )pCXЀhiO-@}ꇼ~6F~T˲ ;nq CO@_Epe>偀҈ î}]#0 Cfc!l7=z1i]I;` JrDCH1+$ hn\{19G995LL2첀@f KTnVZ8/|!:@"d]@Bl |}"^` C~R`%osσ{;6ALb O@B3DkSG^?ؐ #nȅ[>`hP @ F``0@ F@}oOx[- <.xC `  S{ oi@Ai w!\eY~_f 0R`(P8< .}CPxP1x8Tz$w1+R:Ppl$t 5Z`ny<@P2 *i ++$KtqfZx7$L$h!FZSx1Bry0yp AsrvqUbryPB`/pT`?Aq}|{nAMTpxN0UF4n'pwoPPIp6X}KCRocT.` Khzx4e*` %\A ]&+#%2AQ{i 2nB'k82* @@dPu@1l0;rR(|  k2Q :S0F<q&IJ%x@C Q;ДNPD֎~x +QX8*zq !i'`SiA~yGoS 4`uqOb@t 99Xt@Y)X"zh"h#XuhP0[.)&HU;pvB`QTON@`G@=o`Q"0^3%BR{p6|*X)FSEP?+P !PÁ!83yM !IEP7nK@p4ЇA>9p#jwe`Ylr0_F0 !fKo5m0rmZPdD9A>Mys"%ps x!OPA0x@'wД- </6z҆{c]`s`9Yp2U tBe{/!AZ` 4 PC]7`o!MXi#  pHS3k$e"z`\P!R w P|yxbBN~n:oZn_+"JQJ I5PPNtv"BPʼn(`XMRrd3‚-V_ j-Ze+  WyP `g)챖4P:[ `P%WzN(`)k:YZw$0o!iJ!j.Q]%[z q/bCjcc` %`umaE9PO0((S}ϸ4}#҆aPapj[@@ z*03PAPV1J!|APzP**4P/P`8m@1qXr0 >GU@ "#PqMpJпep`r@E:;bP^$ j AYEEp>4&;dn  ^(:ME$^\e,A磟nY"r:lA<*yp-h9E Y@cSD `,$ `H p(>Fiq" p5pYP0Cg~,1u Y(2E0 /l` Q>V`>T[Z)P(`)`@{yp=[|[0QA`,E<OB` ]~ObSc0P_-%I@I`r|[p"qII6noL6 @td` P 8f 7 Ip` 0Q"@k% 6`mPKdBbs`f1I7g{ `0H;`o`4`ufVPpiWf|.AN0>п0߮m7"A_ !R@S0>`X-P( вU`"B,p9:g S2 ]np?FR;`@``y1~9`9@4`CF`Q9[߈ #MC`U9<`9 #p g˼Y`g; up, a|`NMdD`v&aq` PX N˥!`?D}h?PpS(J +'^|DO`&3`nx ;~0c!1 0,ж;}G ` .EM.e%k`spTjY]8D0T ʴԣT7BO+; A:0B om+%E ;<:@o0Vzdp x7@mIY?R -@0~dp]@ Da6pKkn $v7`D`c[&V)d"fn*IШMIXo$`=`B)2uO= a@i1p+r\`pM^ #mt0ci`O )p>0=H8yѭōG% N01@A#@ Ad >?\"^x #T1R@erը1R"1/a1L.Fp)R5p>528^q!15#* _Xd:4>Zś.'0 Xy`@V؁l +P";sK6ψ|F.;;A8N 'XP \ ?H@VNp 0"ذ/$ l" ր4#Qh+J(!.?cĊjiL c@a @Hv/ 8DܡDB );O .{ H\D6,Ph)o@\ ` `:@ e-X'/P[2hGj^5ADPA:mG 0X lz;JB6@K g,Px0 P OR<@Z3 z""9d5 R-pAAI/#A8 GXEK C!.پj8l qH20gEkD@0ԩ" 0x OP<$QBRd'P 4pĀ]8Jx OBX`' Zx h8"iml/=CR |$:Bo@"Tt#)zC54 =0'$d.pb9![m|YZi }@V@(C I>d OAVQ 0p}t^`aB0P *ȁ&+MrP*( 0,d)*xj%!(\ 0 /+ @ edx.BR9 Ei 0w?!00~g! _(g>&HC@SP7z?=|.#jP草KQpr F "T\Xd<ȁy04\ @```+OSoq@}1O2 (qo>';/p>ۂh$H2 Ȁ0$ [ (Xx,7+7P?+ ȃ<85&p )0= =(9+ ̫,ASAP[#ٚ x ( 30/(!c#` /`1>C4#3ٺ`2P  3(%" "IZ x;{/D|<@0-: %Ђ( :T32F9`4Ѐh- 9 F HP'i'"Y-@xخB`h2 '1 G!؁'($;؂PqL "$@v<+5*  .h*08( !8@!% =)!*'Ȃ'&3P)X`pH"$B0X~!I' Ђ$"(:h5:  th`B))#: LԂd/ {8"ME-h 5+yрr؁ ڴ"D+4@=(0Bf<"%D:%;.P`Ё(@ Ё$؁IQR Ѐ%5x<+-:<3#=#G!<*"%%P/Ǽ(PT%ȯOP@lbp1 x 2@(=3 ?71(`5N])؂! 4! 60:"`.CE!- 8 F`.H<HU!!"KDU㬁@(-@9P(8;#J4`\MUy '!(%@!-/p(F?X{uH,(+`**H=(`@/.x(א & )`-kݴ׶I-[ ;:܂AZ؁! ΙpM0  h$8P "5 "}.8(l$ȁ5x۱ۻ%"(.躌Q/XGʕ&*0*x=)!Cm Aܿ}[؃:]:.H]x{ۖ 0彈< Ȃm Dqe^@6@y#Xe?/؀p4%[̋0 (m=P]x9 E,ʈ=$ QP!(;]0 &@:i10;1HUp ؁a.0 9 `&\X460v7;%Kjs␽Pq1 * #ۉd/#c?P/Py%ROב 9pH"@'8hydd قH,h 0 9U]:E)p3Rq?b +)Y0 p%ȂW(Ba1X=pfISfU5$ Uv8@?r g}6*w2" R w,0xp$hh6hh[?胍V18f)H܀X>Ɓ*]9if~%W6ce?"Y`>#p!1ƃ 4~9*_~3p?c?Xg~d>F ax5u1TMk}i.+ Ͻ9x: 0@l6] R38lA@ X+SU '00+ ,^ݼض ;GIF89a***888GFGTTTdddttt!!MBPWؾڥ2,H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8s`ϟ@ @УH* ҧPuJ4 hUׯ`OpMM:0 Xݻ P0nMH   oI=@ptQ: .1VD03Oޭ "(@zd 8pwз XM:2lHF 60% жξA@ &pȦ ( ]_5P 0} \"ag%֡M}wރҍaV]l#dkGHq4ц %lem;fyRfu^& bn)@t~%t靥I(h!`v)YZ))N ,@v%@_Xe(G q}xF:25@>`VV t!YBvG5%'a9_l9V6X~^Ц+yhhRkm& MU'ɫRb@S,#-[q9B@s|rTfDfK%Y\=ʆ=]YB P@_Z!֑-K%e;pňz -1~=X؀9@e[CV3%m5Et(7\)<1(3sTm uF|P r؞0s? l@e 4AH)w/YsQIjz:׮wė[1`1 ­kuVh=V96)ge NF@A RTh೑)wF%{ *y;n1vc#*Eɘ6mp(pZ$beXtMGMCMC2#^Hl`FtlW"%L0CÈ0HArxVȳ|LaF&&72p ]nǾ0!rȳMgx s7!`_SqnAs F:@"r"IWrJD) N!ΓMA"fCOa9[}TLY@Ch1va)ip&ER6A^I1sypr=ٙBCUC9m9t@9)_=uXԇ} 8&̑ΙЉD"#`+0S =C6fl2?090[($&!`afYIS%ɪCRlPB}8=p*ljO$~) aXA^G+inAxw;b^_23qDHX;`d? hFLXi(*cr>CZJZ 0:1!@Al0AҺ80WV6!W]}~]ęm nbR UAj# y&L WvqCRie0 b23SN輬- jY2\Ijq?#7KfO5&u#Gbr%8km#EV2!j29$Jrރ hԴrN\YQ:*O.G\~Y!'Cye]QZϋH7g3'D.7Ip `n8JjʏbrCfKwKW |Ol-_3O㡤nANg)֙ G$ 3/gQ"$?n19'|"o肣+G2{[r 8!GlCU8pA,O66gkwԇ-rfI/q# s߈ +F8DH @Ƣ r@k5fTj[x`ГF%"NZl12Eb#~@1aWU>`[pChXk;i6 o!$aQE @qq/3P!13"ͧmBA'6 wFU#@1UJ R:M$sJ:BG>MPNohi'@̤df ACf糇nQ"Sr(esobZ(yDx5!R!0!d) fr%q&07 ?2Vqu5";"3Fb-'Z#>#TD3t+4`FbEZu8"/4!#em U7B6iL2m2QяG#Y$}GR*Cb+(V S!!鎮5{iF85RSqwY~,&1p!%2G6,a'8Y~kuf.2McOX2<42L!\'1!< A17#ASc#v"Ig[}b#i38u:y+\JK6C1guia4С"-8ӔCŽ2lGo)v.2d'n1Ya'Uz%Ɯ5$#C iב(#!#3{ rB+*{+ѩ1xrB3j!D*JaV$jәp!!R;3pxB$8IXNQr|1ycx9a ~{|XC}&' T cAQ.к( J.'H^'V*y2c!=a<gvUjFMZ )?̱+ $MJ 4 a!~!$lRP 2esⲥ*d/jM"4l0iQ$5*aIhuq5.d%SGc` AQNC!>hQ~`A/3]$&vFK0ۓ RPƛ@"5ƳoSR\!G8q96|#h7a)ȡb1$)[b1sww!qϱ!vUdRQ7szSf#7AK %13T~WE;( A2lQPº&6IX:1# E3#^Dc?$571!`k`Hλ=3.G1G,=h"7ȁrBm(ZWB<$P4G`ar9pJk~#CQ 1Y%66j!eQ׼JA3U?Ke!!7'Sjz!6b$Qku n!hLlSyyuQkD%)%AA3r@&q"mҡdR}_A$SwX,2Qc&n|_#"C maR? 6y`3έQ4EuB+pQ:jRP1 Az"3Lnw}|ۂ"#[WK,c!1!Q!ZjgN-}$k(ru>2 0zA9kkq{z1+6 !@NE),z㠄f$ԃJ"%N1a .lUǍÛ#db7LblQpBJ/(!GBP()A-lĤli#f$D>=G{TQ%lDU~a#`T /9?BkWiqre׷qm^21F \;EO4U (>$aebQo&.) c^y9tADj4MaBHS"f1Y!nD8K}AjCU8d*'瑽/iwAcS fBOoyLo!jmSҕ'HmNuUD {BAE-t頵+UjFaI1cZaEQXӱ^*Wu*:;Ƕ;s+ BK#C U2,DI1ek.%nXrcئuna1q jRZKWL-YҖ4ێ 4!M);\\(~af(!#$S%ЂDs7 C7QR$k1y!G)=Yyu)=A<>;0 tiIlA Z6SLk{xSrr.bPl%mm>S4|fa1M BmL]! -W23M/V/߽W$y#=w,{ͨ^T>t)_m!7Կ1d?jRLaK}QH1RC:#MR̝Nq#YOv_\!Neq)A9&57!dg1s8n@@ TP@ 0XpPD-^ĘQFX \ D`` \ÕKh % ID" tA& P' 8A[=t@ 5W\u)Pk`4 pA,PK ^8y2sX_*i\,pDܠ}\pWA򐷇N^~$l  :N:;>(o, p)4->>-#@/JԨ@i!ʮ{ 2"1՘" p;P P: /nZ P@C іP6ݴ8(;D@*)* r ϲ^/i>N2j 2O=C@  &< IJ 7$,m nrHPN)ҫr xR=_u+P"'\%'_\̀83q:502 =h' 䂚Mj0I::+5nB,Xeנq:,@[G뾔1~rIYﳁ=[x+  hIh4h QHM3uEy]p.ׁj9;*qPЂ̸j吢@^f 1L6:@<^ SFe61; {T"h @)ZfVKf:)' &@r2#פ& l*|z1mQ>}R'.,,Z8,WdȨ8;}{Dɡڂ:魑 pK>r#z:[VHu'*1 º4,' H2<fP9DLB%GE(a0w:LNr;k:@&(@V>ɹc0-w 'p&+RӾk :Pu -ѥ:T:Vt=% a|Ӎ$i=2_`c>En@IɎzP #a2gmJ'[YwRF!@amhC(d6s'ZJ1I $AOA'm 9My%M^t& &["äP ؛e$L (ه@B8%$(fer>LJVF&>kkb.hdKQQ`B2hU}V~ ldT 5,Zn9bG :J3Q, D!#a,7L PQq2( 1)m'ҍ _``~gi* Č0emO SXgqt4ߔ1{D;^>I#2(r!zl!1cH,I7ܙ%(2U?Rc H bj96vR(73 Q>Q?oI/t1Zs#+=G"$@ #4H1X&" Ā /#I)_ɖ, I1[;l!m#+5B:ȿ䰠q(8 s Iȴ*C "_Ah C 1<}XP\6o6* 9)`5b 8C 9a4Iʙ÷k[C#%  )Mkt:QL!Lj;l-9̣(q8x2/b4Ji 0 G%n1 _XG: A'ވZ[ :%zEjʼn=[r(d QG <*˿Sx>1lP k1i  ቺH(G2 $jcAG0QB~b ;̺ֈ ^X1H#Bxɼ[3iQKhHTŇذ'銡:^Cl<:ŏHH/J){ J#&  q(QHPhKa2i*+rЎ @ G I e! JQ-A(]Ih /0siB41,1 4;zJפA䐬A1!K ’081\%TRcm( 8 P9X M|aٝ0B $+YB-!;OHKd:-OScH9I"(P!٭(%!ဵl9kNƙ0j<<`#<y`.rY Bày1ʑ\ s(sa$M6Lciȩ;5{ʩCaRl0ɦӉyD8FX"ix$ A+q Ey+*< P9.-QAVM6Ԋ\:x IT%1Ќ$i C1ΣeύxK ;@ !,J{] s x9rW?NC!'Hڈ Jܥ;- 4 .0BTY"B +P#ERDVҔBߡiS[BI0ԠX.C*|z >1e0W: @ J,\:傑:z(5H{>ɺȽA31t u<E D6p ɏ[r$ZR-Ÿg` 00p>$54`cV`9j*zZF"С87 85V3m 2c m?)0<b;QȒC2e 炰rF/nNDxNወXE* 9b2 qUQb( u?YKѠ9S1 K+H i) P028̿ڀQn1,ur( ib\x}̩#BE$ 8x@ 2l 8``  X@  xЀLP@h&`@:0C$0 EP/ L $IU^m@  @]p6hKG&-l0Ċ3fLV4PCڅ`/yUAkehLӦ@mkh л-(08`0{j 2r 9E nN<{!;lz`A ,@vm U[@N+9֓,d)0SM `mza @S a`W]1 pGR]wE) CpՊρX TQ[5AgPgeUmELU5W1a Y,rdCLRS)L;QTVR1PTAo)d~l@rƖs)9)Ɛ`#c5@w D`xBPpWm uf2Y)p  \}h=CZ5In͕|Y7km7w&]. ?%?^bEsEP&pYWvs-CtH?Y`":K+%iik]IF|m 7el;9TJ^[2GYQTedUb DrIXyUXTDWT1'ZQelՅl)c;X%dfrYU-RcU5 %]ɭ(mj\#tUzxTG%ND_Uw@i]W@r$y"EedžT4Y9h]1 \F2S $4S9Kf@]7No;Yfd}F VPq*tDۓU &4!4"óI|&R $) Ȧ4eXtr X90& YAlS4WL/$^xXE-\O(0mD{~! [褆.2aE8QC rĠ0)IJxcG*aYdv@`iς,#٦>œ ebԔ"y9 P cfI4IH g'z O AnAIތ6,W) H![Ai cVEEr.Xa2"ɕ]Șj< X’h'LS>&ILY|3G 'ty|c8dL"gtԎDW/8%%I.DW @ 0o )vR}qT.r_.$"&JoaddHJ '5*LLEef!?]ED 6l% i7,u@rc]bĐqk/ =H+őW6+ɅB¨HnF|aQ6:9%=_p7FlY "xˎJ_S1,IMz|(=9ciTDT^q0DOEЊ\[ dK01JN,DqA%PUfIILDVʋ q P 3)L\|Jʹ&Q ]HKDđP<ШE-Eq ń؄ b[̅|,hy-O]PA];Zh億KhĝNԑNhdr\G%eؓ~GY VGIDGddhmDUGDԥ2)R>I.\+[h  %E}KPp Bx_O\ zl [*TGS$aal+ĠpVRPbQ! D|Ď0N( DEl_kJT,*b|DWD̫J̠Vo|f`DሕND|$ONՎ9Ř΅ky4ZTJ &N/1݅]g|eLGx.0Y YDsP&moZ@;`#I nKMܯPu-SԆYe=ZAHoи$1=RoLK?̈U`yloF?: 1o>X̮L^T^S?OIڐOZ>QȄ?IKaY[΀Lw$Ċ@Nd:P #JeG| F%A5G.[;_( bgTpuL .@To\Ŧ^D|Nl[G֌E_Dp؍&ğ]T AN*TuE< ]Smٴ/j,Q_W6ЦU?8D,SW<SL$nklEfeOD(Fpe@:I"qT;Y 5#[d~thJT\(mQTthUpl֢i0bO6 `p`@T LZl @zQvL@G XP LAgq=tiPPѲ N@(#`i`q `ec67 ih~xb Z6P0X֮,kP|Gv j2d@z'\6nR̀bТf)@ ˡI+~/ l P*o*!b  4bi6+C+<"ʒ`̤ *L)&x)2Xm<4R8JB(9T ɂj9cS:S,6z=8Jtr)A6z"=P7l[ͥR% jI\[=\2f@SSCb1;|zb3R7I>, Zj3Ժt @"Ur:0Ͳ4H@:!m;Jx%8 9e>;-J[L%ܕx)33u`*8jz"33č7IZMB !SL{o(R-9Ӌ:C.@ҝNUֳXDh}qCs+W 7TmQa4^v̤1$>^(kt,2Ԧ *{5#??I\ |q6**@7%Ѱ=1E4S J*ؙd&yhB@L8yX:*js7kQq4ºp@Px,&HM]N'H^)+5/SD:Ґ_M;Ge)r!!CVše!&"8#> TK$l%m!T^fQM;ͽ͇]63JxcȹgѶ=THQ^f >Prey9IS"+[u*̔@ <0qO,F!sʴ %Z $R S-Xu ]m $TA q+ 8qAXK:ff8ٙPK~ޜg: *]Cn)jM$2)уq,$ K4,R*M!mT4<>Jx2@_KmRYKDTLƓMq}خi$*2Renc2h OPE hTD#7ʻ Xf07qo6*1' ͳ,^ ǡy.ZT$"N`2QtfڝbQd3!Wp]g07\ /. ur4Grmì$I^UBBT䀠IZn~wG77{6cfmًk>)4Q dM'/sȄ/z{X[:Pmi3N#LJs#jY5〰3@TrΞ:Fr쒖pd;6D"cRCR:1cMV{j) ! 4. -s=aSH0CM\*#KAlxDq5Ls& ]sj[>p7YN",P{iXѰ+!Ygzoo,R| b0r{(7nx >~r-nPcH0*fEĂ&/+\JJbMD(fQg.r~)i|gVtER%t4*]|o4$B$|<x(/2x"cu|kp/ڦc* 0OpD`"CAx&mʭ;nlY!$C2G(j4cLC=/cJ3/MqD"ޥqKnr%^2BGX,C(B7!n|AK,JqY~q.G+@ Ubc, `l$E0n'!`6&)6cjk';c|ENP:/ dϞ' 9E(Cve]/u@ (zq5$OS$hGc=S "FAM>5˱@ʢN=3P3<6b'I,pWOe2ܧ̢lch,حW6%G3Фq1CC8T,DqCVqtMu &"_snśv쐤1_ҤLJ bn \q@"9b3eSI#:R85q~g#6bnnŖ,|q3<'ź5nB'" G%i#P@np#}A~Vc<c>X-gr4.'y0 fb)B%dBCl0^,dA@ ~C\P{$%^zD3#<sF">l6$G ւo~:TI/N7mqf "2#P!|kFfbg"A!6d x&9(/On8@]~%4O.$s$ ")ܱYB7CC>=PVfIzh;~ l @"/{L6A ,Hpzb&v沘|S3,"FbŮ}~3`7. AVCģ)e2NVRj239T=KcdB^}6XMc5P`C~)>(c5M:<]X>6 L9&!d:4GCC5\Jf. lČǞT q7+2nkg=VDd6LI*R9*O઄/q}$)\))*5S]ˑ$EvAgJ@b0r?<fIFbAaZ-fC 1.(%/!$MECt╄jz+̢+:LCå$7oT<+KUdpbB2|o,32Wm2%r0~ fDDLoDiB(nl)/ხc1> 7Fk;3~%Ŝb(X$O-6.5páB"Vj\Ӵs/B(C<>EtniWC@2*kƤ&C@N  ꄃ,ڌaHAcbrGG< Jnj:,>Ccwb+jgązf ,*c~6W(ߏ:ʏVwOqhDH%;"O*% U8#TC7^-|G]7,? P1.KibG8437*. s/ޣ4ʒ_::4 "PY 0fv<"$cZFun8Ct?&Mg#JS "ZN05C0Aj_7dxC0d$j# 7GB=*>1=$hdЈSl# nªg,w$_X.34StR%&CH?bqJT(I(2a:' sfZy2.3MBAWX(oZ(hNy|,wт ed‘~Z]14g6N0e3Vnq"Rc"8bT`nFmU1D',~5bX^3Z7]֊{F$8 q+T$9IꌵcX E~)C09u &tvu$\Nl>D-tc'E :~[7ڃ/6+o/PH$Rn$6L^PcO/j 2j6V[TfB-֔:X2 &γ7wBߩG,C%0eѺ9V-$B'>%.fk (s.kZ85O7TJȖ/F?dlxlrmERc5 ZR"'h-,>)"F 6qcX83k%tӷc8)LԾM$|F <@kZgd+(4`i®ck?C3\u-4ƥR涌~ܼ9 E8j'D$J1"%_N~gQ#BD>>c,f.TO<2^zb/)d)`$3('iK-.je) nb]fsGC-\,H9/Э4G8HGiNjq':B0}<3aTGEpGqoUiݣ3r' SVąj~)SBQW*𽶴fXs;b ),ɱ 4z\ED`U()hh%R&I7NI>I&g@rjE #lW !&d5fAI7#^WtsA~"%Dh7z(2JT"F]&,rhy0Z:b/dJr)rN'k?.u\|D|.O°$zqP\>ÞBGϼ8+9bC-Vx֠b72'S@H-rO=7m0>$0>2Yˏ2bi^ν9W<;m~GSSH `@0… &dC  @`@ H p 0r  ,*A $X @LT*AD%  $x80v)DeŒESmTWK4L5pQ^%cK @q0@!"Q%ǝivҖ 5@A LWg gwNv @¡Xm$G` } U8.7HvVu O1S*PڑfZU]nЕ@-ZIRiEK(ǽeDŽ[I. 1SS]hw{S<"hWBVK8 pǩE"Td( !ˮ#$2JU1XCrm %9k,rQx:(5Nz酅Luؤ}ryveX=M0*V#UmBž\DdĹaFÕNwz&/].0&"AIS(i& Sn 82+(h l1Ғ'6 $)&ǡge?qQp0z*M5-*ZKp8CХIđ׵qϸJ\I"#%RQIIT‘ T 6@kVFVhAat1>-YMR|F(z!"h4;!d"iD LL㐥8Ҫhf#| HtI!!̮P#ON.r0):%LNIe! i K ^г!d*3I$WDjjF\$]dPKҚv:Ӱ,xtYQS"(*X^y%!%ZF2a$$z_:¦KsB;l0%A=w!SA+&\3^gO!7؃mt@t bQ)!8/Qj"=u&-*aDQ:f( u!WG FPot'8+,! a1W,%2u'24'"/?"+P_rVA|RDk 10Z(jFQZdHbIKAaP]+za\S9:1PJH5p(iUZJ~Rpp m?r- Y%!46Pr 1C%D2iUBJ#dA'>`mMbߨS[$W&1)1+Uɘ1y:Xy=(^ H -RiqA\ H .)h7uRvsenXDQ';o7Q@_~$])1-"A&FX92r.B%h#6;q{IG5( 8y/qY3#7!77&8G'QYiwtINcp"i6&h"icI!07+ tftSAŸf%1jۥr`n e{$Zr_#9!rEs\!erMN1Q$:v@.Ji!HUMX0^btGM9!,nydTSGy45kcI'ia6"B%MWy!-|15_V PȓrYj12'%vv$#yubvH$WbLD*A A:u~*N"i!MCҚ aOUX$ʭ̖5chlFG1"eQHO,"jo)AJe/1ײ#lwOAF862S;N2 I-0셧fTFQEq%ŪISq!G&=j(J2_GJchBn$պwJ+x1j]1v9udBAxzA#܇S3AhbTr\[)Bq7.rgN"j".A5w!E<*Bvy*!/$pwxd a89e{KSE;1"tearE'4bIyhF9k>d6}rB'aAPJ"fRᰥ%15z<:L&!)~)}~:B$$A8a'A'laa'b0I?-0=td"p&K}jt@'I:%VV'273rh~V.at;1t31l2?C#JAVaB'!#@!ќid2c;G#iOd_!"1C.WC\ACҳ䃱2l~:݃$6Aq$]?N#nbB`RAhc %F=::{+ꘛTisѴrI?D6o=㞆f84s5121hU}:+[7V-A'w$F!4 q5jolAQ6&2ԑð[Iy8$+-ksr-"Q.CY~h5$$= I>ww)&y ,.ղQk[_w4)FFߧ32176nz<56ƯGP/q$*,ĺL$@  x@@ ,@ (8` 8`AUN0Ȕ+ebd aM ,0 J L ؉ԩT0"&xi %P>([qΝ`t6 i`@;w7l0!\Loh;.LMlIH^.O 4Shʸ.}ʚH9M 0M ~c PJ ʳi)f uKVWr$22.Zu*E(T@@Di`ڈ?+{*2-ʷ4@hڙj-FKQNF&Z8>ML()$@\$`ZI0h+<]/ziU]#+)I@, t϶mTt23 z`֖ɫ܌Q˱ܷQ86eZ@$?$2(ťsl)_Ik@) E a~K2XEKi'LL*::fè2ʓ'KH(\ev|va8zIЍS 3P|ڐ|ҚtHk[R)8X-ga45T@IW[V.ƫfnѿ*k)-ó,ʾDN9,z*G*J*zkT1H'(T y,_E!^ hôn ^F(IiOC Cx0!@AL@ɛKbT$zP"X<U:P# kK3=}>=!.J"[|XF!&SDOy c @"iNJd)=ل.jY d*+tKۭD@\L7 * ]dh3 X<'^#:$ˈ{>F6ڒUTNmQOJid2m84F)Jx~'vlS.@MQGN~.v|.aTɏJVP 0P Yvg7I0pzKdR(gZ$xהi*\Yc)\vвnbDe x锠-snXgN+xPU2嘅>LJ0*@t rNZ~P -Ui9q8I?%O:y,tOЃԅ!ݳ .5-cea[B>E1$zXf IԞI j\l'?h Qʒ-L,K)S>R@`Dc;~:X1`U LD0i=Q:'ח(mQRk4YV1ڇ,]I8q_ڴC/j) ]-?)R&iQ/3LJm<9hѦ=JځREZfS-)GW\zxfy%c"nj#\qzߙ4yZq5B9L)5yޫYH7zvh6DBI(L}d,W3X F Sd1H#%"W3yAM@15i<̔Byms%fgYMx!KD$jH/zy=}9Y>"zf@wla5 p{ ^s|s(՗4&Y0 K MN! /R\<XG9&0|<֞3Ko}9&1~ :NhhQLT}/].dH0MQctZP[˘jB&d m4Q_8@h 0(V&g]6:ȋֆ5dF- si0ޮjRڧ2xUHB˷۫BQ:d,cS.W ޘ&PR.Y!xH@y"~ Z@=$kY,<cC,+]:2sr 8;8QYs?xt0+ -)!4> k;lb.{!| {'ih @Ҿ:+] ?p 8IɈ ʐ7hD? d[fB4x>[YQ( 72) 3Fi] {7MQ%#C )!la", {:ȸ/@X- lIj98<0|l,,X H@I`B#D $X9x[j u܎)x%U,t䓲Fhash1y7.bԈ꺊 Iض] Xx*J ,¸]; ~!b٫U-ۉc(kh : !P@Y),0z*AԎ{YX"sXrA^ *4"U+h4ڧUх\Ғ܃)H 8DۗW jczq  :3}5 dSy cQeQXՔQ4(i m#Ɉ!כ0R ԉ 󀡑m (I t 2 0ir+x0X1L-i`e b B{؉ԋLN5!v'EaPBAK"aI{]EIÔU\Y~Q'15.~ p> h`)-CSA;9e'n-A4ӎA[\`]@Z $>*-f/3{+t]7aO@rġǍ"!N\ A&czд `M(ODP)sPv-C'%Z - [05(樎pL-raȕ0 :Yǐres* `j 7( 7HV&"8.@9 ۋ!ܑP] ẍ @R9.PPUK}N- g쿕ȝ T d2k~. h 20XgR͠aV~?Ni*ȥMO!G9" !w  o̐- 9=P#CSx ѮUX(@8qZYT?e+#bq*)_& 8 kL.{peyеoTuĈ* i+&yԦő_ )k)K|Ȧ T[h җ[Hdf2=TFy\-Y:!:pnPp\ha$ ዁0V?p$Uh_8FC4"K n|e5u#G(kɶc澵F*~3܀%[ 9 .ren{ؙ#LpoqOؕ6ceS>L`./9;ހii@i`u2B- C1ýo &(0 nZ`% qclHJ6o<}R򙢨t x T=?ȰZW|\B314(zK|Wulx!r.98I C@-dFJ)Qk !'؜Uݨ>2Ҍ-_4JK!* 8eOW୵.uzt IC5H#)A&E 3$lUT}ޘ.Lx{'cc_ _8@Ș>{̨[v1F0Xʏ VڛqtҔ lX9#oD^oo# !mVGpF yLWr p@(Uՙ*4@Y)]mFe[YڥYXGDJ( n/ՔY^MU'E%~[-`ڦBTTB$q\Z3`}d*0w@OD*SMIU+qwЖZ8Vүj_(IVAqyƘЇ/9^WkiAǑnYf_@j:A"pnU$u6RjtRF'S-%Y4&DR._(5{$K;ʠt@S_Y.KbsjDiuԔL ,LSn@UQ RN9(*mL&BQ>J%Z `eTl?71u:]}z5rg]Dbu1vҌ J,!UE RXb|.mz$ZϖSPRx4V95XȎiwa :VXSfY9\R"9E]Y62@ F wC1XB~FN2#181KBIKr2FZS "8!Vs=j*L&:`Ic萇BV(h< @P8lR&&R=9#|eNaaV6sD 9t+a}@OzadSt#PxVf="TƑW!DLp@F24(=kuENNϩ +iUGE&*b%'ÁfT8bI[M0^2i\fKW L2ˬd]ɹ".\(_}F2ѕcV"ĩȍ4a‘G̘˩' ZdcX ҏL<PEP:$_2A LZօ9ȉEӡ2+K޲Чi-)(h.ҍxAc%DB B r8Luy̩n@a`fMaDt1t5d(vyPNmXݠ"镵@U*a-B549Ĩ*df1 c P$tWZ MJ,2]MoHA JM4T#RF G:EP0с-ѻt- J"d""yy@Wt%c hx y;}H\t=E_ZA"E9!GԚ 81 ͥHToWnI,|DR"|PL@  9 ơ DK@ G,+ޢ@|eH\Z=VMPQG h\lqQ$ʝDA7֢5nʶ)'Q`j*U\@xg sD NPԄFLbGvQDUQđ lL  AHsv hcIpF16&Q uR6UixNF̈#deg,"gjҼ؄ШYA,́VIEv Fz eX:ҨVe$qfxޢZ\Mzl!XwEUe>DP A6X ͩɿ48FL^']UWHNkr߃6 BTR}L4lB B,EY%!@|#f``G9cMzi;>FK4KDXѐ2\>Z`&ԇI]q Y㶄D}Rxּ蜧L{Ǭ ԄuhuJ\F .HWњsPWXGC~+a0eSMp,5sw%Dɪ[̄6Y$M EӒđH*v yL%6`ԅ]kS`FY anCX+YtXm[\wZ&qAF N4AGNYh Y Ѯɾsr4ZSM*. վKbn4SJ)I~V$|LanW^[iun: YE~aFilFZpmPNB u!v'"!rWot y ZxlYVFPٓOE"eƓJoG:..pBoMpfWM|mvl!EHˬaq@xh0ܣp\iZbFUl>G `.qf'~$Wΐp IʖG^1,} lQMD]KlS.s/t E) GMSݣ``ߴl͑&.KB-"=U} 8$qZcbR.1-N.ă,fs=W20kVf*Q:6ܤ6H]8/M/U%Q4չE>O2${/s|,sIߡCtD4{b3F4Ap44D:93v0>oDN"KސVtJt?Fۈ؎Mt N 0qO;E}PS3YYTpPE1BQ3UuXCPF&#tȕXu[CV8u^u|y4s`SAI}^6O;JW7) 4aKvA[ǁѫL,WK/UOgXx|EeEBqJ/3h69*Ž(IrvnK=rE0>Dn7 LVkEP}]8qKk񆺆LOHst{70/ i5ScCwgЦotԼPmQS}lxCsu"ď?!~Et>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JѣH*]ʴӧPJJ(,ATʵWYٳh "@8iʝ z˷ߞZ0È]yq@, 7#KN ̹3(?=k2⹵kT ? nW.N{ 8!EAJ0  N@O$Gr`7w PQ %>P@4 6#e8ËjXN"XrMe HCbpAbẖRҠ-t@ghLid@AA2:^BNX b pCuRd[ 0AA,C ! @@ |\O.K`hd60n` i  N?L/9\NsG) C)AȰ:"zP2`0hdKr`3 HN  MxT(SH` >@e0 f`,C' PA"'j\5׺+@nJZx!P jFp  %蠖2 a.:d:v7@ r NtU*A /|cSܩ"| Ѓܠ`@wxRp|Es(@PH" !Щ(@\Ѓ|#;|M2"g TcxB pp g8S4 =D AuB>dAHA=8h0]  :.@!6(O@ ZC $W RhAH0 +Kip/EZ`v%K0mS0 `a> ??G@jMfdB9/*(M fw0 pa7+ l(yUZtN_Ч'M{)d ;$J` fa0`M~4g`Y| TSba<3Ʋ?l1BH'vgv`ҡRs JTb,'D,pLv`vmX@{&` o#qJ Bb (DGk-8\Kpr~gpxpr I,Brt1{gpPڛq@&QQ,T}1kn'b{jUeb_p*#Їi1^O (p$> [3.pi'%ia1(<U Nc`eMoR{-ppp0n[ui @j xTw /q!|lQ*GZ\5jP/ `B` o`V0i  i@DLwƂdP #\,C0<W 0a1a@ Wn`P1=* =Y+|P^(P 1p?f 17E7pK/#;a`ץM4ptAB0}@&W5Phfq- OsQ/3AH a\y 1Ab/x<`@D xV@K S- zR("M^;yaЧ WR)`r!I-gpvZI[]xtP\Q!@O ">PY_bQf`l BbJ!'y0qP09zEaw =p38 ipo#=y@+~@ *yPS>K+ 0S@2pboPJp{ )ypP@2- _`@+@xCaP163"v(@]RpzJw[)cIБ0/Vp3IKR +yf2P'rT}^tP=i/Q'x<n~ r+7PHQ$*s` [.>D/.;J$1`?wI${Nq@M%D@? DVPQD-&SGpNX @SABLd*T08ETRM%Ή!n@& j@`\Uh<@#Hw>$#Q pQ H`[H &m.BJbӠ(b 2A  @bd=Ѕ:!`ȠUgBc^XHr@ + $ 9E  @'7Y 20PY̐ t&n`< lB*(X E;(a-;@L,/T*pҹ5;I2` QC>//FE</9uZ-8ȃY&P#lD|b "pؙ '̂4=:/[Gh+` .xgC#C7 c6)Vs@$h&<PĐ ؾ= <E< : $! 6Ȁ4z{`A~t hlH؃aj$J/ u: @Xh BdSI :<H)T,H$ȃdQ@Iļ87&C5`3I, ?\ ShIXT;Rt>' `+0P8B\!,! ;ˬp60+, xya@0hzBG)x;؃0$X,s  PpKx&<|"hB0C\1=D1@ `.G4.HA 8x (!<<TP04ك5X"?@ʣ Q0'6pL; F'H年G>`1U<;H= @҄(ɴA Fwi(<('ـeS0Һ Y% !PC* H6 Tp 9Iщ̒3p8a7tT0#R [I ഉ*8 `X=o;3#ӄ[Ix|ju\q|h0j>b*p=Pģ(T`CwmK"P*X<5 fq= J7 $HWօE < Ê FXp &(0ٓE=( ! Y&cN4 8XMP(y؂؃0UH;(5 F<J؀E(;H)$`>h&\Y !巊 X2)A#(Y;bq. +'xۂ&+ ,|->o( H pH9X}c1Ȁhpل)8(8BVh'H1S p$ "`NK9 h80杙Ø.h0eZN ]N9H`_!!(%K. i: h'\Eh;4)̴f0SRU356p9` `<‚C9 Ȃ0)[303-g^" ^6h*%hȀ*H?P:x=Y5>+U <@=(o1H8@70-P87%h(-88==nbZ|䈰:90+YN>P> >8Ѝ3HJm75PJ3:8(XgV@4Vl9̕& h[*ض?004Z0?:Um‚j?`fHo<ኀ7)%j8 P\` g#%!&XQ@QP-o u ;`^ )fX0 ȃ p88p xP)i (j؃ փ@\5K ?/"pmNakB? aDzaK;@`hf-;gwBnj HaXrr/ E RHF<ΐP~΂R;960=-9H9 pΠ)@_ o-aX9tЃׁP؃{ &ؚ=89PP .lT%?6M 3-99DE=xa ˠ !8D0=ȥ>w2Sv?UF)➈^YS80 b>8:$`3792`zozH< 6HF8^A0jh28 I]#'X2`ta.68!7 o*m=!bH9#PqHu]h')VѶ/8G&:;9 -_  ѿ)$K}3٣ PVx{#HP3ȉ$0lذ*'6( aƐ"G,i$ʔ*Wl%(62d8rRɅ< \lrCb 3%S'AHj'X,3 wBQ•$#42$0/.L ;ގt'\T1t(?CY * e.lFdX2 R"xSR aPM VZ3o9tV(XAK2 O Ӓ.e9œ)2@7z*It28@:G1EG GqDC$ȐzUS!>@C R A Bd,ր~/kG `F,ĐoN FBDDv {hK9'~ D 10&0#y zy6Zt ,ЧK&ЇK8@g1F_4@&-iyofiG ;,`wTPwl1E-q-)h&1)? 7b~C!@ C5@GWuR|Qr@ {0 >lPDb Nd@}/ @g CH[X9R1FY 3@PWv/QP16j( H<R {˱AlH$ BSdGLFq=o$PKaq;JRX-5azl`KT _`~&6w! @5Ͻ:{HHU*  > A%ԃi+@,]2hp6d\LDyw@T q[DK!!@3 ~7,@zP (%|@! L.\) C Ђ<0)T c2 Nn`}aN3(`#T@"Q T`.xJϹ X pk .0ĆP BEe=6 ^V$!I`Aj fCAp'X$&|R@{B%SxC@ve L`Hh@ !|L @B*p )K T C6KdbF & pT9 ,xC(qi%FU= $́° &C5: @b M'``(@A$dSWMB'a8)c 5s 0Z2"~2I F]]P@$G8I(  v*L@ C@.f ?XƆi%@Hp%5]َ*X@^TL ΛHe Y* :\ v6gҮICaJJ+KtiHc*AZÑ;:L5d@84`-A/! dɳEd9r e5s03JH疨v`$AskN&藜n*`% t;pqšN3{0A,ەR sJxa-Lf/ - fAZ" $[s5CoIPmj`YJ>20faЄ.O-Cp$x 6h|Y$E.Ķ]i@pkJ"`n <t*i+ x@I\$hx69Q6OX]/ XuJܕn"a6l (*@`$ *o;G8,0]>r*<@i Z ``n%]BI?%&5 ?>Ri=h+'=p= GIЬ09ED;$AT|بaH aAЀ`q!\|wIH biZsؑZ<J @ˋٕLYkA?L$sDTgyUA؟ԍDpE!adJD$lD؀@ \HH`܁ i] \((X@D@ (լJÍhPXA؁<J,"lI`A .&N#Cz\ A Ia@8bHX<ՀYDpH?EH)#IQ4r1:Dzm#LXu#fP J#bkL@HADA օX X KJ@HbI8 s!ENhD@daKDA xXId P < @WlCAP` D^A^',@ HeH0Dc2 <]W@L(uY. (dJ@`@&R0AWx ˋ SP%fp |@S C,H9mŖ4D @fG,@@u$%Y xF6VHH 00 A<bDhH $0_,) @0 &VMTDH LH̨aA`K EAD) }@h9@r%%JA쀊2TA!|CA&vZ4IiYƥ0@l ߐDlF0@#JE(dAH@\@@fAKK0%NC9 `d"85@Y 0**d@spFfArH<Sp -Aخ@5eH2DRe0 IABG@1fpË?{D`ƌr 1 B4b+:'A8b|S!i&8FiSOF:  f0&$b:Gw PrD ? #)"·?ijtH#JP;2Ҡ 'sq$ fϟA-# !kرcpFTh1sB4m4#HrKG+a)dW >C(rIc)dh0ġBmOA@h\wxk:X6+Z0BvA'&AtV v pH0&J0OrmnH$ H`7 Bb ҈<7!@m#Z"Ve>xh|f# č!$H0o05bn `$ԄN g .  #)f-7⠲ 5^# Dq!j6"p!H4!VF\ah-$L FB\6P<q0  #q> Ԃ!z 5"!~k!l< N`e/W 2 ⣒- M(7`vzO7 &=V bԪ]3& >`@$H`  D@B Nx>`2$\CF6X`l'I昀 @nV< N @b8 6+~[ S( 4C V L ' :@5 P 0 *^bCT@@T t9* Xb2A@ ,54&@  7:L<\~ԛ2 ʀ #~ <74`U뗄B `l*$-O-^qܠy!=cr*`@Xj0v& f>@ Z!r`0t# }Z0 v @?UEqӻı;*!Ѕ' p sNV~ + @8@ ( ڼʚ &m1"6 hm@ jJ:L35,@X!\D=DHO)q!P]4hk\}}\ XT 7b  Fe!O)` 0 &`V2J -('}Oa0{I=#`.6@p`Zt 9 T@ , >Q,b 4`݋7 \onK%^2?°pWw>̩N0X<) o~/` M,  @( n"!:`V@@¿!+pޠ.iji d]IQ+p# @؀X > ?i@@0bCő5R",   !8W`AD )E1⏍^L@ @dسc Q-DI8t0Q(a >8­( Ο<D*VXR 0O 1*x`!GXS QBO5%1*"qB8I-T 0m0ڂ-zAҀ\~?1 t X 1g{ @ ܱ7x<Gr<`A _H0t ?P@ _pPEI&uPpi]^eZNԇ WX1 XFx@ae?App{ <(LB/EV|`-4F6qo\=P9WPR [ފkY!PI_Iv@& JvHz {0P Jp@l 1"0QC&| 'B%*DGz<$kAk_\`P ( efG4k 45 ,AӶ!ЄZ6D!y0G !/ܰ],$F 6aD F'@Aa0Q4QAAJ`n 7B}@a@j!4s`W .IADDjTzLЄG40]0 H8RTq@1BPmP 4AB6q/<``}A Ӈq<xf "Qb7>PYTR1v\ " fL7l@?,!x19-%` 'B `= у bB l & v B\ %Aqh , *BfpXa/,H,L HBA@1r$IƇCh@" RD%]Bb~< < ~* D`0^4 "P":"^9L   < #ȃ dVЃ9{@@=C`xa@ AE6\Az(AtP5tmW DXb0*A9* (H@4 -H Pm h3ؠ 4L {P*P *laiX@薅,D%0\ < +4? ف  \(Y " n 9H بAj0+j/D XbB8l_{|:LL X d dp` A!Pkw9q2?>d`u r@bCtS: iTv`D9B DŽo۔XEgT~p"! `mD{`Gp!2Q<`OpGLӂ2?prPi@pcb`sopuDEP{  ,xxg~`2_G? !a[v@HO|ϓ40v[$l03 00XM`[0`<7tF`a`YI^pX`*,R I"7v7aG0 !'b/PP p`KP@ p~_`vF0\MVTGWŕp$UPD3\&Yש) ]03tݗ+ 'pPr!Y%,g8[= 3S@P@3@Cpi WԵ< zǙ}pՠc91 UL@&&$`"pTI`=@/):Pbp+)Tc|wvN}1 ~@S2 RWK`i5 LP73va`0)Wxr0mh.p/g>0i025ʨ^W@B@C,c9 a%0r4P\ p\1\DC`;'6{PCf@H;dg!0yJ#>7}P8pS1D"DN[M f70q Pc8E60B o~'0 5pnmT0!&RGj+ )P+dБ9JZSPr:"|&,2X%,HBhBZ@0tui|Q-U3pQ@Xupg1IJwa p2@W "ZR= [6Var-'cWۄ)raЧaw-c'xa !PCUءp94}z8pprZ6+a0{0@˄qJN,-sE&ɲ!" JN zX&$ @&`'PA4U}k Ч#p˄P>ΛN#eP^";Vr&@x+q`9!v^p{[1w .d;EPMƫQ܄84}N Iu~Sp{+9vPH#&sd0>4"{1N lM % t60nPuP úȹ J& @f >g`|`KX}{Nc0P=zPNJ#>Tȑ 004 6)R`<$L*}Qp@={a7A6A#;&In`#]!3yg0T(VSyAC"ЦѻmD[QRp}+Dh ϚFΗP'2w)&cnTug^N]_U1iP.9@uЧLhi"^+:LHp>_6t@g{Gp %8T 8tW<7p$p {c)Pv0GS륕M@0xz̲,ER`@w+910@`{p{`?0ZVu+@0C0]x ap"+\\q}{p?`P`jV@@|} CZ=ro009_>0 <J@:,YU b p.@d,/qCP"LP=o |0O7p`s|Xqe9t|sj(0VP"`f6"}pW0;֟`F| !pg3 $XA .dC%NGȈс"kŋrdd@C0 Lt Lc !5O\hU:nI牖~DDJ.0-2d% g3Z![&$p%|̓wBCPj\iԩUObWx3 W5W+LA&,@ψEJP6Ay6栙}FqF >$H 7~(k3‰BhvH2ʠ NX#>,ƨc9 rHFX A(#F+ z#V2 "0Å0 96BPa ,nn-*:Ѐ+@X=#(b*`/h/ 53`:& b hL ‌`0Ȏ0z@NQ 6jV Ph*b 03``: 2dsƀŀ JD 2h n!XBv%x -|n*"(x#f!7zo!t JJ' KV HR6XA0l: ؜G7AL@@M8 `-p a$q@=|% i.:,fDb$.A  L@k /Bdn I)CCBЄZFM$ 1 @AU0R 50cLW0!b`k|@k`IpEz )q⨐> ? ~R 0@O %|xpaB`H` x)CҐ1\ U]p a ;dp,\7">,xvD-8@_ !TypTPx`M!v mn֗F@4ґo(B36#*HCZ ؒ}h!iHSÇ=XW"ЃU!72(`4pRհqJ3 kaVЕ 8@p P&$ QH ` ,%( ق%}XJHdX"w0ț%`4HW9Dg?;`D@] P 0 Ж 1O.P:0d C@;iW5gȮBg=?ij3*D i@âѰ< pE)Ѐ/@t;F ' [`Bd)HsptpfaA`Fv|âЂ)k4A # `UA`Z zQiD(:Ї$X. #H. XL X.[hd 1XFf v$ Z8J,$0Ïm ,CC ib3_t]>4D1gl֖ oȃ~9A bG?=Ana/90,PaHׂp 41G J( #hX@xu0`THH6<(ۙ %| ΀AF_(P @ d09 Q0*4( "`t `u20L X3 ʄXO K5/'v8!Yx*n7!&QЯh,10d@%  05"*Ȃ@#@*p`.'`(0,)2Y,\/A'8~1 x# p>8( Ph:`@hX>;xC9F *z @G "A&(?U"5 2> ?(>H_L'6(a p(HFe>4((c|?  .ŋx:p"ă2qX3p,Gp, ( 'p'6È@P*HGd$r_9xBX4(#(@À(pXh|Ì X@3 ƌ2*6貆|_&@x$8MP`= 0XE0/j#-؁"H<$p(8 z xh+"Kh $()'@$1!#H9<>6 %AЁ8x,؂?h (pH(<((88/2X`,pJ p!ǰ=x  >->=>eQ"ʌQ<8<-=@`(8; 3PI0`? eLˆ=P!X2q4%0.ȃ*XR0;P&?D 68ph,P: P:ϞQ[ " PH(8`78 !2 - x~ px]h>(Ȁ67"`1` 0 X( 0+P0`@%03`;-pH*(?Ёx.0%H _$%>*5> &| !?3P+p0 !)<(( 9C 50X8#=``YV "(!5KȚXP= .P a+^AV5`(.[#cgؖ/職 d,-:oWgo0^/ov@~d.Xb> (p%X*/h N2/@@#.hYei@ Pcse:D8P܂xsJ؃+p;`n!m-+H hfCc$`h20+^8+X Y_~胯n @&x 8ЁAђ1Q=`60p~"&Kҁ^t9.6؉ Řvƈ?P "8XH;p w oϊ" T1%P!@9؂04p;`?Py pՈO)Xo'f1pn.7?Ѓ+`=)@8d%P#8= [:?#؁o+*؅`h>t.XpMX#(#(Nto2Px .؉(xH%%(׆#x=F,8 /6x: X#=rs?->(=5  >p@Q=x*p b2PQN(Y62 hP#\rJ4bu `_#ˌX=ȃdA3? w4 <U=8 0 +w `y:茁o_>f{os_|Ӱ xP$h 4Ђ8t}/(]}$H>5QL)/!HXpL$=hqQÁ;؂؁hWe` @,!9P0@8uM3+ q"V,2-7@ Qb;> 0@|gΜ/7na c=sp`0_Œ)s&͚6o̩s'Ϟpc3( /k ժVy&5S1) D @& QOOo P50e-!Y v1|X@+0@*G<X'(r@TyC2It bL$5Y^l#KÏ/0r hM0 '0c @ x& F5<jpp3\|1I`PYԀtŀH#k,.A6phi Fc QB^p o(@KP E + _ޅ0 xpWzĀ l}RZL`(U@_|QDRCV#Ł)`رnE2N0^1! }  @pT@6$xE[lZ$p` |=1 @y/ s  _aG0@A1A`@R]F.#l*+߄A4g\s2pBg86CK0Lgqh@[+`AH[DuHF1̀ 4P4T 6x װeGT0<@|0`,c0EЂP|1˻` p n-bMT:_oD@ _PD @o0oZ/oHm6 A0 7 h2@I <؁ :T;A KxZ`= X݃Z7a>\x0:O s!2@fd `HC"<;`; D<E@Ŕ@!0}.@ @  G%Db@ <n * LÀ%dh Щ2T P )3^x J K<< Ap @x`-B$`lp` wC3Q /8 T*  e \ AdRl`Z&DD ʏ4!FЁ#\ ݡL pIL蠁ԡ&|z#Sqs B`i(A(wXDjj -P% @AlS1F[A  DP#A,gg"@`H` h%d eFp4 ,hA,)H!PC XD 5~) l 8 R0V(}t0! g(xE%V],)|A R(Tr 82@,;`' `[-@ Z|0/RCxT@7"gC x0"(h_A@Z-05hh!UZ,ItX |-A18(N7 +@y pBUv>_iDH(` ,! w5P{H K--@  0M-NȀZT`T7Q, hE*-ڊ Tʰ0a 5P5T=>!eCuPc1d!{!|Ic _B88!A P(D_vA 45 $Ad@]4D , `@AE X\@ A@ @D N p@xx @xADǜ4AAh!DzDaAA@a@6A F\a@a&@|@ A `<ə D@@dE&5@XZa,A.A@@,F  dNA [|CAA<MD؁5VUc @9c9Apc(LAP9XDXc2n9£8@ԁ@@9@<5AD#o-T I"W;JuE}(dQ18 ! % AAH  P-QlLADA4DY6A[[ZeA*@D%l MAUAME 4] @(@tCAUO)@4*FeXM,1ף1b1X,i@ XO '|ȁl ip8Bg TdDl gv@Awv0xgwrvtϡ܁W<A 4dt xv'~wApH`E\tr0 @Z!v@Tip T A D@ozt0 X@8Z DZDCA9FAF dHpJMXրhI@)AP0Dr͕li xxAtzVl)^d@QsE@ @\`dAml$@ i A @ށ )u@tVAx hi@iAff ڀV tA^l)Xm<ӣm@hJn[0 HAPL)qثAXk 2[(@*2NXA\ X,m\C=\@Ś@XĘ@ X$ЖnŒhګ@ZRŪ2DTdi$l8Hi*ZLFl b@)1| ̀t^m @ ^N(8AxKTa HVB. Xܮ,:Alȁ*PA$u.$lnAE`^jZ$p s-ζhpuFrkWG4%GrPA% \Ms$;DA @i@,- 4s(MT%@&/41 1W,|  | 4=HA t?xAH`APDД|l` ,@PKT @O `@X@ <5oH< DQ@K+“ADȁti IaE䀌<h AXOSPGCL}Hv +@O@PwH(A| 5  @O@``uTxtR"P57tug5Gv/Iut^@xA(MLB0a @@0qNAˈLDLCxKZ d@@8*\d@~0 A|b,@TmDĀp(DL 0*ĹDtԁpĖs91W@~LGAρzAA/ @8MxځlAğI@d 耢`x ܠ\uA p0X\G|.ܩC PzQ\h dpJJU.Y$b -/A @(}FPП@ 4 ؀Tyʐ@{? y@ sH`#vpin F*qqs+vL#Ex4=1i;Ɵ7m<#QhGΟ;0؃5* DPXbbZ8Ëp` >58B7  (3j!p|`79n3ׄD‰."8rJ jG9X-ԼDMR 8at3DA:Wp"3ؓP>{3P`x72<56,˜ Gx6(6@$`.zN91`^yULlU&0(xϲ:2*X:x# 0D?x0l9865?D?Ġ24ܤAD!y^g8:!PXϴJn!TQ27vP{=唽c\* /b@x ! jr낤]N㎪Weef mj2P0 HP>392#` -P B&#%؁@"nN( Ӊ8.80@ۉp iН'[N)ڏ;Gُ,jB`{<Ā +}-KO߈e"nB!h$`Lp.3|  %dkQ@POszQI B)@'0 L`gR2>t-9pa X hIP ( L%.*ДR@>P{`> ``<f|@RHNPr Rx)OVfۓ < ]z Pb=@<@ ˾󯙵LТ-l3}8Y%nbeZrX oXg0-0h LXb9*| ]R^2 ʠZ6 -F @BdUB 0Ɣ4v@@XB `0( jdP De ְ`c Jq`}@q]8F< O3! JP<†)\a&X Y(Gǖ(avCI0<#c`l a{x9 P !͋:6o\y& #,/0j0UA|= {2aM'c];ap`(K!]0 mQ@6imh+vu=PB a7h^)nn1! ' &-LD0(*k1k Q((! 0(Mv 6\ ZZ!3B0s1 Q0 ė# p@v@g Yۋ]J I"! :BB)2 Xa4 l q2`þOIy;Ps3}(۔,  i0Bl,o =:C5o Ko@ ?Ky@D@+h@#5~^7BOHowb!PB  d {pf6;? ^ NoN`N|@$0@ҀLn0oЯTo@KPPz@[ 8P 梂:c 8t@Pc $*`H0%t`hXO ,.1 o01T< DQoz`d 1 @ @] 'rsR31 1J& az@yRO2q @  1 Tqz  <($I`t J fJb( "S# +$@d$e ڀ$@ vj"B2$$_$ %[@'% r' zr50#$P%` %ep%'#P ' " zR+{23j@X^ "݇MH2 $zB Z '"0/  -5 " B22-2S2@.3?2!x* 4SS5U3 T5- T,TFZ3M`37ӭ t2I@v@55U:#2[`D% @8T DNF̀ n 5N@jTs )F0p >d:*r@@ B 2@&<@{@ @ Ǫ JD@DGT$3`B`@|@m^`B'd f F& 2  @3`F( @`HT`H'0c&3B@H4 V`DW >ô>BFô R4 B ,`: tNM@4%,`O@t 4 4Q @ Ȁ @f`JP@B@h  6`( VUk- U(&l` @fER u4 $XZuCX t4b4̀ UY`5J\/v8`\lLМ 3]P 2 ]u%,``@TB$fT@`b6 .$@. ~~ll&& b#ֵ ` L,- WRV8cl @jd Vi]@i9Z@2@` BeR^l3 b/hKDn nVRB.nqg]&xm%Fwq0%D~ @ n 6%8oGR@tEonu`q5) us7w=T+/4`t Π 7#@[ 'l`?kB{W{z6@@|wF> @v`V`| |ͷp{D @ e%P7|WH  |z` `x@{`|` {vns&nz ``{h <@Xϯ`*3 tR4p d'%x*L: _S δ݇ >B u*yH_@L( X( D[ 4b  @% s\"u* !y91 POY *D#S!<"D ƀn`e5 u)Y - R` l Z wld d N@lIR`<V! V;&`gw`Xjfx 3`C5%& DtZ~  ``yO^]`. | P`ti` D ` D  ! b, 'ڂ[ v *.b>` '` iv ^'6 b!@`t+-qB^ >F@X`h-L f>8cF@ :j ;5` @" b@ؠ=@0Scsd .W @ V2 r%p d;H\5^6H@* G@`\ `+ ` 6Zj o nVD]?2) @ l Hc:Fp Jd p`^/@`,qE΀;*` lY @@ FZv j[j\f-jLl~x2x:㉀ք`0 Nk@j.nbfig>*`X@`Ij#`œ" |``ރ ([H i\]f FV9/H^O xwjB! }`@~i^ j` [Y t@kDaASTPQYX\aeE;Tt@1gNT ADYZoRŞ&8pO1Bj<  ~FU`%찃XDqF5'  "DjQBS%hf U,q>+ԞUQ>5x 6pC 4  Aۀh6\k@- K!Mz(4 0 60D @S (GQE dnr`)НZ0r4PS<D ;kF GTWmXߤ (WTAh{`>EBptם}x4, @ mQDzK^AHvOwEe{p3D lp.;xA7~#( f9gqpsPsxgQœo酲aEeYoJE@@ @@h yC dہ l0A f xgM  !B8)H@Zh}b؁c:W<V@:$aR"'o`P dw!E`_N064 R`Ny D%Pp` FPPV6b: :dS"XvDv0X&%І( B/$a۔SbPVA \ 4E+U "B 0x&wXe8<+4A5#D7 V`)'g>7 q (t FPS*0@`hIV"X7UKղ )p+\Y`e=}j̱*P* \j1 Vʄp(p;!1M(|uUY; b)N`֕qAZB@( :ݾ AL@f]H.F/xA ,s !Ar!KF2‶"ȁ-݉/tRHnjF(^IZ| @uPƹ5P%lף5P {xK Lb@0N@R0 H pBa )H `[500 :l,4 2A2?yAJpԆf>ԠDqr  0ЇV$ J7,~ F!9Tԕ;V_tg1!J`(k؆P?aXlf;#P-X xM Fm"N N$^%Ms*p zHa9CW4 8AЂ!uθH qtKa(M栰2f ;4 C`@Pr)(̍,¢I Kr"tc'v@P4HwqЃ\Ag~rtyfG"n]': ON!UOZ0H@~@T4X40/rS"7GZ6A!<8308kN%x2pGAE~+w t*~Z)_@N)^xd%5q_$ 4[!ex2PV8Gup-@d:0r^\gP_pKZTLXn0xP}*>VGPH؋h!a8[0;U;iP'@$@P# @[؍@Kpg+D݁gg+@pSPh@ )PK0+0xM`ym ChPT 00+P8+/)38@3pB@"+0%)p>PS!In@iy0f @ !%h vgtp@\vCW(`KP9fo@#9tIPo9PgAuY y94SoPOyT`ZDP .0U`B0_yrAP#Yfו)uFc D Y(\**ʉ0ʹYlSȓat 1[)ʉYD0)(@LcC?cy *=s [@=Bt/nS P?T[xI@PPD#L5JuH2:\jk4@lpS9`@ZFzGDPУN=:F?PeYfэOP=3*B]973zxx R*JG`1ГMQD*<*b2c  &!Y|Joy:>{@8 éQY!lɝz6Gh`BqNESC\PC1v wڭ*~>­ U"/Jp?/b!b=X`0x/"x .WXz3;&@^DJ20%& BUr5ypV"2;s,R :$|iX/PKP P0(FPq}7`Q(#'p'a&P(Zە^-MrWCXP@;@s(0/Iq-U6p</$ q;e,SMq"; -P#CJtR1{6u#uq.31-ft[[kP6`7au148=ԃm"`C-y9x`@mo=- O9C>YP6.;g pM@[<uP BP[lPB' lLh0Az|I{PDipA K`BQ@TB|*NP@DM)PAu0@9P@1B =pAiPY ,AZ@nqIxAD:[7AN%0[-}mTpa>K`[$%&KxY4Q#; k1py KEJV@ `CpJ K:% zGMWK-^jŤgVJ8)@I$~P[ EXzrgA);ppSqhPge[23,PW(@[>@M^UvA^ A嫴5+@C[+7b,pFf2c slVp"QAO8uA7%0qb\AuSS ,`50Ύfd HCrF@f`8\yPb,}A7b:@p)Ѕ]6701@ % B&y%Es]]i.PL;;AP>ݨMۺ5H ~TFvh@L9'60Lќ6LBa3JJa0FF'VY@V P (#6`mEl$~t l8 #q.|0mO`mNqU"}<`3;&t-0HpKo@2Em0. &CP+@=p2@ybM<gQ .6(\\ ?> P&+@90xt{p:OaSA@B` d $ &HGD:g,BpAFCRH%M3E *V HęSN=}TАvHE!{:Λ7SV,X4 xAmݖX' 32W}ga 8sO';2LVWxaT3@ y(Fխw:APǎ?^,XrGkXə;`Gú!2 dv`-DM3xp`!0$Dyz N4;(#hbjɎ3 X``"2ʑ(aȘ"TOJ/)C̩ fb@DB-ȤM;IC>Mꣁ 0 aȉ?'RK[1 $hd4&:b?Z*$H4VYscYC VW3l<蒌7*5"95أ&ҡ hu<&@[ D%ZBh$]W[ l@mu0I$v[h)0 4ea18& `=%1]sI"o#摠b &he50'#>H8 rj#hb:8g>!;t '~ء`( oF@Pb "Q%r τ=hA_A$ Weˉ*&&?=:8:! H0:R=@,XwOa 4=eYP@z} !}5vx Hރݙ0H}#zxy@ C  C$&r"$»J j;HGk  > * . b2x M@A$P+Hd Uc_p8V! UP Px'Cy Dd!I=CЃd_ARIvғ- B R+f@kCN: hp@% PBz w3< ! JT"yuFjGC).tӛ]`m&qCم @"DtD"7IE4@׼X!1A Ŝa p7!fЃ @0!DXUӤ'\ Xvhb Ԕ#@KN֭@MkZ+ըVd `)" IV'(I+OVl@"`?A@BJ'ԭޡr$C@h.& p СX.&5pB 8-KU@`bat@_2`t$ *}:ֶłm9zډp^pSZۆOC054  /VpxU``T oɲi@rhTX"g @ع/CK:'@>LxقH9do>HD?x0liMğNQ, <@1RDT ?UtQ, W+ PK]L(<^`dw;;GIF89a{)()989GGGXXXhhhxxx!!MBPWؾڥ2,{H*\ȰÇ#JHŋ3jȱǏ CIɓ(S\ɲ˗0cʜI͛8sɳϟ@ JќpӧP:Xjj[Êҁ]˶GVպKwU *8@S<%@@#KV@@WAC~0@ : `G6 Uj {@PA;@͜O1Q^9VȏvCVy^@!۬5`J1"RV& ja) p!ႾV9\ 94ik1Lcz Ȋa 3/H!x2 ɢ&F;+MYF uE (@b8xf_I@?=.mp"q8-LB@$yNÒ=prct)x?{p^t_(Zj <V,6_&œ6#˘f>Mg.ǞMBik>7N8z2-]@?uMpJ{4<_z\A} ͔2r*> !jElWf_*jQmFVT b`Г)YWrnR\QKUXz,BO"PASTu_9-hJ2Bv"@OKȽ xtRMceuh(̷ֆ ?;m{Sr1/JK&SEo;W(BDcն)"3 nvSiZ~"ҥ;,C6A+(k =Q̿QC4"]/Șb[3SVA!0*Q:/ol[IiB8r}:g2mN3Ya&kh; S (y%OJT*t0?qm}E -Lqw $|R@92"hީG?9SrءI2Ea!}sy-HXCAh{ra&C DQ&40wG:$&INsFnʵ)a%zE"6Nxs•4SAtϷo8 x|31k")e't"8΁^ 4c:OR2qQ7pU5(BdF+1%^S?sU6Ԣ-c>RSC"X:*1@5JJN2kS8Un'@%n-RQK"+IHxEa"#SQtRၖ;LHBcfj iQ9}%8Iu\5%k@W>y{Gq`KA}?*7 &Q`c'Z QY zC}ԖAK6q19h/k$v q"@z\,\x9o''{sd:A]xviec,,c(&3AKf(نS+bc.9q~VV(X!fa0³sBX2DI1#M$74O)A%<^,zffgq U7QB`54 BGapIGW< PBT9F GVlMCI&4v'bl680Q#3?]9z2 AnV$sJOjȫOqSS#,Kq{3a,[:|C.11@'E M\jGV1fǟyƜJSYҺy$x;{L2XfzݘG[a>QR:F>YfD\'5eHUE%OTz?\PP];ź3 2t/DP%S!9gY} IvsK*e5$JK W u)r4A5\:&E3tI7okBؐ,?@#r-{t#u.4VLN͚IJjz\sgG4xeaݽ]0d<:_4%-0ȱxܞtr=0[Aw-7U'!Z6HDBS!$f6_A+2ڂmߗ?R>"\e8ɜHa%v*{_.N.}*VWLC^zezɉx.cԝ=B<ëa3~2{x sJ: 3t7 jTcO)ڏLCp}#GrMҖ 5@jnR~%UPj;kO<&뾺M j=5b&E'05I.B ֏LQ.i&/mw\%(lzWY0H*īd(ZqZ22A҄IPO|A{!/@⋱Q4nYyч0Y^Q4gMɱ![L0_,ANrQ#O.tWгxA<3"Z{U4%bޖe"5InE]JLQbf6IF8IeJ"4Ƣ?qY@@pPPB 08`@:@F= l@%MDRJ-Y"0cB 4&`P"$Pf0 Q:  <8 'ʟ تt〮b͞EVX >@@#Npp@˝=4 6ՌE#l@F!\ UoOJ}C?}ˏ=~4@x፣$$& 0d^t,J8KN< VR) Pn&7`D>p[ *ӌĊ0]+ɪH@p"I-D',$P%㎯q!?ꢐ`OPѤ(.]bJL(ēr%(5 XУp ;xD;-jjΊ4-ө h2OQG"(J{ (<8uBDФ|GSzBVR]6$Ҏrde @HiU"RՒ c R212h&c6_f1p@V́uiwU`9s*<@|k5ބ“X_ //3:ؒc"c]7(/(`f[o ц6WixV0"$O{W:f# ;X6(P b[)y;O*-wn f6ˀ*S"@YT?l==eim~Gܨ$ٚÃ?4@.n r2RDꖽ,*MM>vC9I>4HJj!R*|ޥXk!@ZFUKMn)z;꼢pk2Y p Nt IjH_BO4]o'VT@P%YJKL8)$3YTP&8Q<&k V@=dSKQda8 arDаTR7)6,Fd.tLsCu[D$6ƤNCVm"Y<|i,!G9VPRPh1zȥ *&+L=( ` <וqpW Ɍқ}0[ #2bCΐv|#2 G9R/MAO3_+5gD9CxThx @&5"y&Z)7Ocv'a09CrQ DP8D 7 $|ՄD. N gr \4J+ȋltTVխ"PMEA<3<1O@dcM*/K>E%Be+M oEaQx401]DhyngL:59J8ā N0m*,$cFaַ)$F0TK@ĶkYQ2Ņ$ "miO$x렕GE/^"BR."-#rdJ]Mњ$zl1PY {P錑!R4/0)镨`C0Kr bJrЇMBX(2&"0AjeCXT|B8,KAio/QhRr\2PHLh],pb)WY4;لo}`䒇t3 +4_%aiR$TKa'DhfD=ʭRidRh+f2RRBށԵ)~j*sDŖsCKisIPcRrT"J$ /` '(#QiUY&bmW/@<s~*Ɵ[. AKA$q -^|X*\mS>\@%P=9JaK^(]A$<;!Q Z:;Ĉm5hB+pBo{pkKBPA(m gI!`P5N wAHxxLShIETgui-$6Ę<<* u ,Y&A|& TNt5RO$@l@pW{2IY#LƲskBqs) mivRadEG@J`I4tJs,%!$%\"敯$Ys z}tB[1).P jNJ2[F|DAHf\HT:v$Q['pI'꫕":MX  [C@.B /!h 0,,D0##>/`Y29""OʯR>^죋)gئK !A *Z7!YI̙% {YbDcGDʼ.CD7;$<@T gB[, +#I~rƑI_C GC ʈH8Ij*p)ؼa!]YƐ6! 4KܒFQBJ'[ 1 8Č6D5S>S#41t>T tBMs:y, Ɓ:1~ ي X)RH[),(j jM5\09ڼND+;zgmZřcc\U%i-%DijB!D *߸W! xHh(?{5PCQ9"yњBH7 = H `/-h|҅(R)ݟʒ!©"Nâ$)<žQ #\]90#汸"KQ QB*fѡRh ѳ` ۻ0l@ecI]V՗X] \ wjGdA9'@հq2a& d&Ҡ H8E`t xY:Bҏr&S͘"|ճsm$rI{|%9HPCyAѓpςҴP'@Ө\D} tR# itI"r:`&eO\ E'鉽J; g} ` _WT/iNQ (p2=YP-pHek%9Vx*wBVX@;rr9 ŪKG rmSu` ('ÌBΐ gaZȖH+h\mIQU882"d]u\ $@ɝ $~>P(K=ь)D$끈Q P-X !]Q ) qX$hD}S"F@QM*@^0<qĸ+PY c;"eߓx8_=<z-hA*#ˌ8Ҙx'M ;ӊڼ<  fi(C+JFt?םs) 퍺۷h;hԓXb…# q/Q22Q b0:Ya(#V 2]}rZ52cѶPٝ)sU h=s 䎰g}2f 7 !呠p-!t `UY)bPX"]8V2#abG8 +ڌIسF*4%Yi"XV̉dn_ 5H `ӏIj`P8 K'u ;OdsVTŽoKIdXA~=: @ ; I(I=B3Ѕh-ġݝR~s%h& |y;Ad"bPi`"]߰O/uT(:LCә2څpܺT]YZ )?uᎇ*`,KށX`űʥϸ"B T2 Oؼf791F&6f fg HSm a'5@܉diP#~X5j: Ψʾ(KĐ0éJV3DAښ-R B4K";)%2V|5Y]׳C<&FQ"ᯓj߈q%." ͍oġ)6jba@p` >IxayͶ YKDI> 2I!pB=.;G2EڅƊd+HBӪxMB M^hr` w,, ")>Z/ S8PIfsws4 0T 7Q@ b#-&c $˩hB%V*km F u+d/i~4QZSypS:п+G%@)3uDYoh %OѷKSDqjy߼M) +yaX ~ YOuONw`:UU;¨\ Q3); zqb@"VIaw5NgegfƽZy ͘*cN}Gl Q>diy) W5–Q#&7Qo>BJ E y֨r1ƌ K؋x/HsDl 6)8Ԡur3Xb? #7ݍb x~m16Xee eKOߕGC@49q9"R20u>'\ᎋȪnm9@)& h ²3JaL"ﳺ0 2l $@  p#Ȑ"G,i$ʔ*"@B 0r%(Cc *2( Psb-R004h`0D`PN `PAE.l0b 2\PA"?0'$pj:kj*XL3٣q@Q:@w ^Z2ҧt]qPwH9wpYH5Am:dy2\a@U~%Q5@iI8!1f 4`*^xSeVce([yR@q@~*)WP)`U$MĜ-_0IA!$CM@U5V*Q\ )@_9'E9HɝDu:cF)Q{>N%UX tHݝ I(F^'~B&GXnSJ^JuG0ԁD''QX `j-^8Ru}*aDžF g X bf MN%@Nȷz-|8U[%Ei@,PݹExF Hح)$W`OXUY$-dRF0LZb"Ct.=x E-Qá,@DKeuT%9]gY"]'BM풔S&h*T?gK]Ibl `Zc;ޝƖ:6H 6Sƭ)%Ky vS}6@AI#1Кi]U=tnI5K YzbbG&2tDua ި߽S-~z$ngajQw;z&8)Vr Qv+,e*i`\£'0cZ_W  f[eN&.$e镁䕐 6\[~) >jH~$ .t6 .MKRcebsN~d5ڡ6 X`)E@TYBPDO(uncdC^TF--ƌKW%,G585lRNbd4>@řyO\JcUlH5%|lʭb٤Qۀ4?YIxNVDP ]_j)X`Fn2L8En`K8!DUe׺PSgjE0J[GI%QXPm@RH[tH\fϹd EoEcr4*ŷAƂZVq$D},ǂ䠡gAŀE< yS _~d] c0ǀmD1"HHALGBa6wSo9"Ĉ|]0itU #ƅ`iLN`4 EcH=(VCEYȇLi N "tEOr@ -_0uShe߀Ldn$zIFmH?{މtValTfpdHULRjdEGihhpՂ\]Dx& -m :VNDi1Fn[QAdj_θ*A bppR|x-^^ [V@L۶Z'ҶIHSH+EinfFd^r [U/S9ըԉLğ$  PH9aɋmH5ĝ婘^KPzaOYaJʀX$IP2צrȄOU~4*.,tDŰjuP&ɾ<*oP^DŽqŅHPdjj/0 o e mp&XYW/]c-sS.ںRE FujT2&Qf"7=E WpJ\1RNwnd1 *tIZ0]UHT n OzYxѡJi&[0şl%/r/ғ4JKT'VhNDHmVAFg݈tQEQHķNʑlyLrX/Z>$HTR\ػ Z-~XUqF*c!kTEpqT|PE$\S) |pjcjqutDq|`!mXڧTH͔CXQT^)ItFm(e@BFG+Eoj\ &)˅]Ĩ$'SPZ6XHFTE)Ƨĕc%KRyHho Q Y< $ˈhu^DS]51mǐ2ou u,%J@+-/zcI1Y-l&Č939E%bgv- ORwep)UG*YpE6@@Fh^R9Ls W^<ѪmAXDӶO]VO Fr7TGGgRhEEU*ʥ Y@mQ%pen$;Ru@n%w{l+V\uPA dx VpI) YPW5,}SGn|Q~2q}JgitWB$c`4{Nbqvel<(ʾe؀Эd%X/vAOPol@s6juoaiHF~$0O,9FϗZMt]0W#ԧV1fWU*%G4,cEYI}s3Oyi{ 01`|J@E;3{Li_Egr f')=6XVx;(ua~jMwۘ\rdpF"Ş 'e.E8=!~m d)G.mwoرV_ͱqb`6ӥ&VVRp>=џ|ntEψçV gϹ@$XРA @ ,0р L81 lP0`e8HPXg4Pؠg ( MM@4(2IOAP 8 aJ9+LAo_<0_ XV>6e`@JUkR48@}t qϙpB*pz$H & vg޽%-x@M.*@`hzSu>ߏCodxW#rPCS0kAԛpANç/' r[/?O ,)͆p&S%^bp'b)ßL-CdJ`(B;-#T:b 21DF W)SnAOEC ),slri*ɡRK-1 r@BNŜ2DJĉ┭Y6O+M#T&ۋ=зL\'d.dȨb}Nt!غi!jF-pϜu{EԽ`@% 0zN9[@z ׯ AŔT(HL9ҊҰ'K*S+roG >aNxC>fx0Ƥ '^F48xs­Ӏ$ӬixC+`LK`F4pJkꩌ+J@F@*l: Ǽnc̻hB.O\qmb3GSK. DKTy'Q@Ni5W7/V ݑ L+}W9mECvT)G t1)JQEJ\$YS5=N@'?-qgdLdE6QZ0-#9cb&})d',K9̂"tn:b.18PPy숀o&d;@oid5kq?^/A ` "mDeSTQKE-Vݑ@!oifG,S6C"5MW ~ +H)̈J,h,\z#K+|/SUbZKD&]4%X@6KPBH8Dy'[8V;fT211Sy,y0S`B.v$/@d"dvC,vQDlʮ1nB7E7qbLNkA*PRrG$*P)tfa &j:$/] Я"隮Ē,b±T"KNB@ME&IΗ)8Rd4_DVXHؘ4ׂ*AGcG㣾1#*"2 ,~8o9x9v&F,*N`Bip2!nD!;snBtFBDSL&Ti|_DE4o $C!tKy%L#р4f.GUΣ. oNx4뷲B2…g2T]cPٔLO Pr {D+}2Nܦk>P!4#$PGMiZm-xa|"@Ue0LgIf6{h#fQ0c>7(TVytriIvD[hAGGL L6 u)K)p. h-BŨrtBTz-v}ǖ.Άt6S]bE(#${pH>U%"8dXF\JW{H-E}7~8gnuh4@θT}V`؎0KWHDS,K.)ԣüNHBKŃ{LU^qaxgB+L$ c9:#G_"8Dx9bHC4&eʪ2j@Pحk7@>(65hE64 ; DANmO{3Mdh R9lvePKEn"4hO|B/Ĭ1N/H?HQԢ-pdV꣝OE8$5T"G:[=+sDhmxXl&-uoVoifybg|Iy"nNH,f#ʉ.AQV!~0K[f["г3 5;e"Hf%\l8yHkR2g-e2/'xxh?:@sDeI&p%@gʊd'W=RNX,(@Lgʛy?B,G]piD+d,ofP bf2`b"-d>E(Nt/L+9*qe2c; ceLۅ4@"/͏ŬA#$eSrD69_8*Shם~P8SK^4"¹k7/ 'Z%TN 'H#Ԟ^pv1tA(@}ӿ!hDEfX^8ƜSˠd'iv"3"i$5 "?bSv 0$`jkn “N$ @7%ĞlB`;~"dzJIL޲BY,m$%4-Otbc"'yKNz/vjIA7hMÕ $|P ixUj1 bRE~VVbPٓim+HQ826s2et`zDy LC}}QzYV*#BhUP됭Hh$ݯ&c<0l-#)#I Js7msTpD8%iDk<|4@{+\tx'¥̫cxT'Jf?Rx'2YG)ng4(xrn@TpLp2A @0:=4ҥ4YԥK $@ (8 lXX=6ڵ+ (5n\,p`^{-@p]O6 ,B|( S p9m XμTh_cLM#)a d=h3- K A?n 3Ml6?+La8P:PAp?Ǚ_/q @cv_`pGJ5AYɇa7}h,&.C1z !nHc6b܅rkq$*%c wcRNYT_A_ 0OiE m4m%JdrII.@4k1։h1Xh 颖^Je ~% yPJ"wK@Jk*JkFAk-XqN-ˬSZb8^mK[.`r.g\>uh|enn*[K/YoƗ@ ph$pҴ ;GIF89a  """$$$&&&(((***,,,...000222444666888:::<<<>>>@@@BBBDDDFFFHHHJJJLLLNNNPPPRRRTTTVVVXXXZZZ\\\^^^```bbbdddfffhhhjjjlllnnnppprrrtttvvvxxxzzz|||~~~!!MBPWؾڥ22222222,H*\ȰÇ#JHłYȱǏ CIɓ(+˗0cʜIfE 6sɳϟ$qfѣHT7MJfԔLjʵWYKl h̪]˶K_ʝKCv/߿K+6sxA̸lV] ̶ͻwS,1M808D6μ/*ǹ%TX#}Du[dS@6B_ϞEoO> ŧwgRam thv@%x!pw1Uft m ądq@ݡbB"(,pG 4j0@dL  u ԇx"p`>[ yAcDC.YwA` :Ѐp@:T iBcj iT a!DJa !ܱF|+GAFؠ ߹1i!>BF1@chUud tlH FXT@VP%E M4V{-M@IJԁzk0$@= G! tR{QAq@{ Ŵ[\ %|)!lB59kv1<A8F? @L{H(tC6q -@,6D!w !@d=T}@1+6q`t  E&~$F l CX1Iwx7 (PNȐHAH vEv.TA. pp TR8PA֐1a} vT%v6?`!c0dƴRP`uGI)-3_`dA]wH:"aZA vP@.2u.C:% a-wary~^OPVqa`8}P00+`%APt@5'u\5T:a6F2`Kp? s48!EE:`| $O !I8HMoybk160~gFR ,,7t35_~]@p7D~ qDA`}?t@+pZk o J; xm+H[T067<7 `[@p5v `VI)JFY}P |  98@F`d{m-R}50+WP0 X0Y`l0| Q?'|>K% T@pz](`0)PI`6`lX<<.H ~YsP9s/9 buJ f#A@1`H0. E!xx t;fI5Tُ !hA֊2+Hm S60KJpR`L:PU#pXwp:dfשr pOQ3zQHRD0Kpw+y#`fpWM?WrS$$P 2(pPPce`4 c[Ѓ EIq _hFh~}p>Y` ն^N0E$N`L8@yPcV4 fK4ХGgv@!xSi`9!*1K_t6&fqGH hj IPKPI @{938X ~;g`0V ypNRpTn  rAY\ p (aP}i}ڡ 9PU9$4J A.0+Ƌy\rU[rh`}PI9Pm.@p{F4#sT@$E,f*p(l5- < ɱ| {Xp:x\P$`+jk, -WlxC}C0$_REp* %m#5^(,9p$uB]- R!yZP`2| RЄ Clkp q^b'Y:=B0z'j|fP>,|`~q&$!PNvU07(ӧh&MkP3 ?pPm wL B`X,uBvy)qy Љ<xP  $"zO/*\8`.o Cet*@-P-r\jQ5` KzkM0 !@ k=0V+Z?"A`p)\ -a<' 1P8Gn-Dm??F rTa84P;)qq=lPbP)v@q P0'i'@-`p ?;e6m#B9#DU4_ zeLjM+H:Qtp)Esp(] BA0-]`1ݖ.Ģv.pnPWDg[0i;Pщ ' lY`7`'Pep^R6ĂJ@PSdvpU0m]iU/!*=Ns (@K0}e }K0Lde!/4`B}GwsQP 2C, F;K`#@I+0|`P#s:sD,%@XP.%@~>-<%t|0_p Ta$?p k`$e t ewpA@`PM, *|PڗU艞Boq ^HxngK]Nr77\7v CpT@ _/ N-x0IRqRj V^m-_0KSSA_PS:b9AJuXd,{`\y`ƟG4v NP4?ֿs O`_h `*)^@ FSpA QD-^ĘQF=~ H ,QIpި }(`{&)Dp YX&'Dh͙')?!A;y*CswܴPQ\ B$ܩC͝>^?Yd|,q8O`F'FQE>Whr +m_Q3@C@#Ǖ#,#"PG?[@19 L8<ƚ0:zO̙;C搣 9XCn`l0`&\ ?X@AbC<  "7h >l":#% /I%&9…B , /~d J(60 0h`(/9BN;I:7nx ?,".s,d ,  /Nn>R=@=LOEU"H"5$@1<B@;ިUx9* `":!8 B € dHɏxpԈʴ` ~r:p Z_P8$2TXh ؃\⍊4` .}"`s?N7p@+Ę( 0&؎l( $!`Ρ %؃ -C '#Ɣ R`go>> '#6VC~H9 B(` @:C%r4VH *. 8Rɴ'@/w!mU Ȏ $"ApN,xVۘT3. |6"⏛zw „1h h 24N%0 P@H .L U Cж?+Z@94'pZ@, ;xA(R ZBp|#F09"1HO2,AA|kaSU9 naFְ(NBP;\] G)"- ` ! G`4q#nXC$C$v#FNCn$ '`  $&8@̂\$ R7daxj9t((fee(Ct, e⠘DRVAF,Aw@vjj3&aBpz^ՆxdimD Q8f$XfYC-BA'x{~0 i(j6%@p؁a8l(;`xĕA1rH$}H.H>@NA%O@#rH[%<+ FPpy7xA R B,huJX02T [@ԉU,6@ֈh p d 6J!9D@5\a K ۇ%9%Dk$8E <&jP@?`ĽJ#h!,>I63 е".ՁiC ɒ]9\ګ+. >XpH!x<8<3H0P@