India_Its_Life_and_ThoughtI!I!BOOKMOBIY%$k) . 4 9X>OCJSM[d?lui ~e"$&O(k* ,.\0U24Ԯ680:_<>@ hB=D?F$DH,J5L>\NGzPPRYTbxVkXXtZ|\h^`bdfUh^jlwnaprot9vx2z|~!)y2:BKES[dmiu~ Cm4´Kn?f"+^3;@BBIDQFZ1H`JbLcNcPdRe\TeVeX <MOBI1( PEXTH0 j2009-02-18d#Jones, John P. (John Peter)eProject GutenbergiMissions -- IndiaiIndia -- ReligioniIndia -- CivilizationmPublic domaint a,6 @    +India, Its Life and Thought 0spanmlns:x=".w3q/1999/">AolýM*NjT1peiP="1em"5justify">AOR"'BLEM,RISHNA CH`T,"KETC.,2ĉ7ߍߍߍߍߍߏϏϏϏϏύߓ{Nework 甄THEACMILLANOMPAN~W1908dW5C(r, A,fh5_By('&@Yo="2o[ix]To9eopleqWesinhabitantsreleastnderstoodoimisallenItsartbecausyxipodalAfhemovedou؅life.ԂNlssecretive,RfixperenniXdeȂ8conceal0ev`oo7''' AccordingHueachcSup@piritoreverporHilluB tinuous)ans9tsel1rrH{horms,hichudyeastray or`narmonyithxhilosophyDivinem!tot؂xsultit?RtenOndcepxhimves.1y, exceng`difficI脰espechtAo-Saxo`ypaphhefusia^rectrifLhl𚯿oooooam(w*discourag[oAness pvello@rushȒ8aur,ublisholumeUirh-digeoriaboutera(armph0s|qquonyce.߬߿ǿǿǰ???>0urthisookakesolaimoightYspeak exathedrapon)subject.everless,rtyearsf8turedxperienceland,ivingconstan uchithXeeople ptudyyeagern9irXf;thouP,iv(hanumb@+omoree

Evenw,owHpridekledgshasten@byoft-recurrsurswhi؈Oqtal llʎ.Pdoteasepray,[ae(rnainwho,᐀ epaalfnyworkorWIndia,ailyȁut,>"Oorhp 91xGqco@o)i8eelati0ɑj%m!"oooooo>If,BPcaoW@faBimmenhri0Prom=froapesiHhX0h䚂xlaɈAAundhPpet2diQracxic3̝q|VedawfeelmprepaidboursǛǛǛǛǛnjXYrmyeprȗRev...arton,.D.,Nki``pPtpublishjt;als'׀(,.A/矀rouxroofad8blockquote>`PONESϦ`="2
[xi]CONTENTSA/sPAGE耪/ClىXyilepos=0 39520 Hor="#ff. 'snt|фd3421-297i.x UMov׆׃׃׆׃ӅCauȇggi44669gga5O7560553?Resultsook62904ooj8_GEHЯ mdww 6978wwq2gOOOO079213OOJVTH HManyaPQ1430-7H`uismMadxB80o2w_]D@nolatry350ǣsChranityTravareCoc488{47JudaYo80oWWarseeBombay907140φaino__l2076__jO76MohammedXAgDelhi77D348ߵ7C'Buddhj,arnath10133w箃ϵ׻SikAmritsar__|8261__Y6O777712׿7FBurma, BeautifulwwwwCpwwq72-9{r> ThextentfpBritishmpire72i.riginǫNj2259ǫLjbǫDŽ(a)elouheorǰǐ495WǍcǰǰlj>bhbalﵯ639?K6cSoci׎׺{78402W>Occupat￯932K?>Crongߘooh52xooi10WwwCharact(sticsGGG?OOInmarriag9004WOOer-dinpϼϼ6180ώ<׼׫ܼ߫߫tGGl45G9OOOGGCg861#1OǴǗ&PetieOOK7279OO77Boycot׹WWm417Tw=ervants diث0OWWWj691WWTw____\Dome!sol178267Prayaschitta. (Travell`)////7/776="2"'$83''!V. induyHm YinuȽ߿29423-151 v.assfunishment <(123ChangeFaith41974sMarryingidow____\6995__[6_____#Beef-eatȍ焏焏瑩Officisriestoutcasts8427wroutsidjOne'sÅ(eGGGGD982GD8GGGGG v.heesultsQtx y8m9122ߝ9KPossibilithGood____3793__Z31_____#It aygain7wwww195116ww2wwwwwnowsSympathoooooooooodegradManualabourgggg650g gggggopCommerc///787׶/Ա////AoeNonay|9295ׄIndividis_߿߿߄߄߿߿߿߿ߝisnecal߿߿߿߿250߿ߢ+o߿߿߿߬EiKDominancrG20343,GlSeenv(amoChristianoooo6228ooj40ooooo3Romantholic`ndrHstantOh_LoMignBixDecp////,9351//+////O2dy׉erngresO___47G_47____$Govmebi491 䘎 ؿ6369d="2"ץ92׽׽VI. BhagavaditaHinduibl$OW|52-18WhasӤwwd1854wwÝ׻wwarebPursCP0迧607361.ɡTeachiHcohrnYGodk319o6oncarnalockquote> <(163220-241 0r0+d/2>i.hedealfodt
AsceticismHiry Lege@x288 0r0+d/2>iii.heoralharacteristicsfTimeystemd
Everyugaastswn_
2.heironceptionsfumanife356Indi(SpiriG77743077߽77OOristBasiWW248W\oo"TOrial "//ϼω5106ϼϼ91ϼϼϼϼϪ74'sords.ׄ׼׼O(repmon?׼׼׼51979׼׉{6׼׼׼׼׼ӎI''׽׽iv. 9Ary???776??:40?????%ts޽GGGGC6045GGGGGGhincipleWggggggggg6Agonismo4it1822S3 `osophic`Socie???3185?:#0ff">404 0r0+d/2>
Itseactionarypirit<olor="#6Mrs.esanooooojThe "Masters"''''$8847''8d="2"74241XIV. ÅProgressfhristianitynndiavϏσ16ϔ12-443ϔϔϔi.arlyȄo@'ϓ%ϘϘϘϘϘConverts____\8900__7?????CharHertommuCϝϝϝ80102ϝώnfluence7=ߢǢǢDŽ148Ǣǒ9"Swadesha'GGG}2999GG"20'''''#test8ffor558߰ߜUltimateriumph/705785NotZWernypeׄ״׹ϹϹϹϹϰeKingdomaGod5635kマǍAnquվ5z707w3W1._Principle72'!deal60275$4ϳϳ3'MIncarnationǴϴϽ__t704__Ͻ????<4ross991ԯ|5׹`pSinS1282G41dѿ="2"ݽO746OOJIndex_s38oo/tablediveightem/>
[xvii]3Lpwvh2cen">LISTFLLUSTRATIONSFrispiec(iPAGEW 8613WGoldeniPTanknMaduraem0803߼c456Taj(hal,gr _0翿Կozpos=0 99214 >Marblecreennajahal <(
INDIA:TSIFENDHOUGHTaseenalledl0quietXc omahanrohoaryast,drouJhermmobility.vasixafX|isweptv;utߏ7J"Eowhlowf bl Thspiritouits`car#warm9expx|opXiJy overnmentchemtwo sgo,dLordurzon,rYsBal.Ԍ؀ceeseenXBȎmHirrov0e;چrobbtcleabumanyMplumoffice.Ȅeedfo(agit'WUdte@ain,Xrgan*aoycott~IXQdprcommerюҗbducwi`maisrega0people ownHomicte!,Џ1,Plop8oithaci8my.[3]BeataHail,͌*!)aredAstPinculxeech,h򧡢ȪpHilegQHhe8m(nmselv91qPofmi@s pxa*` H;b0X8`ifultsYeȧEa!׷;񵸖aflicttwMohadaxHhn`L,0PRMusЮaxrg`ajoh󁕂bZem˫A2stooXlorӣBX2d1o؉J(fahs,aeelQ{?ӺP]i[mԹcampؼ:Iwatu0__[4_^Α8(go finT?cloyaltyyholPu@׭׭׮׭Disgrygradu@Un(ri"ool-H@gp Hpl t*$zinnuyrPfuppldegreeslyeȱhwX1570.A.'s#ې۰Sn-qhaduTacempڷQo8Պ.ax@sibl nurrYaɳpow"bMmgero0!goguꋙ@.κwSfey޺Ŝ ؼSҺ*Cpu(꫙mrihwork0`ȓDnu excdvocOOȶRXiapdiaeduȱlptu)ѾAhotbedssfooStBu2diffءXۜ|mmoruxXa`pubXti;)xo(o1)youXc2¾WWWWWWQ?CXPsidera,ggc5gfch4masseNO5popuT)ˤ.ǠensiIor0tngJdeԪxpporaS va8s4@XcXDn@{yeshouldٻQgh"郼peop@Xnopؙ livelymagination,akehemernflammableterialnder)uencefloqhteogues.

IIOn!mostrkedausesisctivityndisco0؅reicto`Japanussia.ɁzhardoWetozeowuchatv!has `rrR/rquickenambiڊ8allpeop4East.heygqjwar Pagxt flLj͆ndiado@8s(htidea;[woulomriumphaouBinstXsugg舡oJmeculturhp"Whhbour쎁bubje`iar-off,jamH,yrnuntry? _)withdepe)rȃmanhooapro ssdid?"YsȆhriwhi0hav upewspxr[6]ow(educەoo r؍tlngsetru$SHa˪Xoraٙ`tJfcon110al44Ufc d.ς22.6) rboyBscpl-goagXtděk2//girlye[enrolQmonX(syRub\ysifiXhxfulӫХp؟AU'''߳tXQ8h𙃴@n UnrsX+fآQyous:yg2w@hhdevoxgzvЩRdeepud˗簑l*alcutta(lo,A!affili(lle,sinarv`,ٖ8,rt)!ToroeI8p 鲠 unt, 12,000_C302pupi!HӔühoof7GG@Xdwanjsn(r볁ͩ;yoiIwor1)assspiitt("ؗ.">clo<䜏onoclizÿIChron2HbuilppiЬ#nim"b؉9iR'!dominWy"weowmak[0GCywwoub(ഺbGxt„aiY؁w}Pss`lofOœ*ulpdid;cquȀٴs9powهdHth??????">9sgo7numelKEngډUleXtr0retuweeppuA`o-Saxhu)'laimswwwwww">Nʺmave߼Peoкa1tgoishX,ќqhomce:Par0,аaogeQ,Fpurp8prom.icןЅׅ׺#773877xvaisowب:!beliK0HmYlargmef- sAenjoyse8spportunukomeovernmentheutyfrantingddedowero"people,ndlso8viseleaders1Indianoughtsirxstedjprocedure.here noewadicxnrita@whoelievatld `self`indepe(colony.Hyou(with(HXuouthJgJEnglʄpixdiscontaxloyaltItonlyBohraqLordmpllPrn,(caٌЍ1insidihhfluenchich;`exercis!foXthrowEAishȐEast.

ationCongress,h0Qeachitsajoy,aafoud`lop@aMscnrfue8~ polɈp yisHitu xonvhacompliYBruljSb@mpossib! imagiYRuc:permitsuaod0!gaꙨHyeasolemn)clayoYoteI@hahec(mZРrincipacؕ[9]Ukmee:1906!ЬYnypm-wahN⹁voirfli IpXP+СȰ honouri0:p staghBwhpap(hehh8ival(arhs(lÁ8p8Qcil(Fret9BInuratdModtXuExtrem8scapиȊladuBIsueOlsy (ambnoisinz) lK0辘ieˆ,sm;upB.hull deAor/fs''#10//ۺArϑ"susb5!uvadPacPapac leaeop8Rmselvߡߡߡߡߡ>bihX,hapkbAx8Ph PQ߫Lelfa@ed:ktu)g,lf-(colonielik0anada;/ꋡwݘ08n@tabliswnruH{V0behalf'ducYy8ssib wa` !w''''''Itho؋ d0fromݿbirxoY\f-Ph(jnworkith+har8succ]at!i`la`Rs aims777777">AwpgoSخ`ged, 8itXdtdicule+N:wTo-dayHignPbȺkxoȔٟ熈`HmoggZtr`H0odfulҐgaɮ ge" xula:reUKqakhurunWWT1WP/span>dredanguagesndialects!heyonductheiressionsnnglish,hichs!nlyniversalofcountry.HaurerE hardspoken!anyeliberatregisl{bodyEo ;JsomadPsrewithHforce,adornlogichetoricytrueloquent.erily,zweaponpopular@weroughrgesHagainsbonm,becomplihbloStatrhasredt.

@Љsomarvellouspgrowrڒ*d(ituringlaquarta㉈up0tisco1dailiescmm؋8ekonth3pub!)nmbyn Cnd#iscusrintigencscrimi)onpfotmodҀalltRsliticX8ReyOsaphaexIorqrad:p:wtPpoHsϐϐϐϐϐ">ButՕac"r,etohunَnew`0AˏInycarrAit!fl8villVhuucm().I k01Қbeen<*[12]Aqfacȡϱy$񴙥㨑gtjh"Ânor奠h` abآolԷbu8aXU%sa2rOfreedom©ceech`H,xhapsm0cwh)czenċE؜eq۔6ꈰmad[pРײtwoPBengalecew쩔suلpouljEuropeaok(depor(8.pChdraal,Caltxl08ur}4et(jad Pndeɶȼ8stud0۶Xaffec:em0)u19onenc8okޘXn+unre(nclbЪ)orgԨYoUabX!tuIZ!wise!f ɬ3throwjo Hasp ru uY!rui`AXorБbgnxgu 0imCa1mfeelapowAM`)ZP؜th fȚgraشbsolv(sbroad*8revqOOOh2cer">IIIDisi0ihsa)h!SZunHssqadmini00aihunlIsAnnu`Finanwe 8vicHQxȴ" ex0Rfa Prgben1c(kn30ruP 0ies;wsurplp`2.wosǼ¬uUopiumulоbݭwrou,(즘m inrcC8a0ǩ@po@lcilHKr @hea*mxi)@H8yKobnoxaltaxaseeneducedy 50[14] Awh3sai-axtnndiaPeiulemb2thȈHd "hea؀boivilpdouyorld.ussia,imeseaEng1,wyItaly, PetrFcem-five2Unib0Germhir! ."Kds芗coYponlneollrupee艝wwwwww">Bu`zcla@sdeepestovertj(@fecrue. no +incxsParsChaiBombay`ockxcgX [ualddres"PwconvinpYt0bankeryradesme1captainsindlow@b(stiadvIaloxpath"mpriHprorit@yjfew:؉akaccelerdceۍHyeniygpoliticalool5oopa;ry`vdX;G,plor:tghbnl[imᑩ//////>I,ore,)styieldgrowde𘒫zYrgHshaۇ publicpH[ emolutroffiűp!ietQ[׳ach`k8ce5gn w(4owx4OLi9wffhs[BhisqX@reniossHIAƲҊNJƤK_Mutii half-a-cuago(Iloupiadminiato`m.ӧ noK g(c (ٷPwi@ smi?Hthu oɇ²c@Ƚ_rtbharmPire)dBhMwaohampa˜ikHloyŔߺwould a] agHqpfJmselvlɰituP6well.n>b-kn箸lȒrofows: "¾nutsйcrib𓂴Iwordsrioxfbe!؀ 0HnС񿙽faо8Ȟ90 YߕOX辩O2.קɔ:ɉ le;,H1equYeཡ߆"״״״״״״ҏ9la D۲Hn8Xsiix,romXizpo;ؽalsoiss`sfilc}exmPbeli`unjeviAohw0Eڙ?ɓv7ŅappSrЉmyZstudeo t`pulace;>agIoroughcogniz—, pur(eHXHXfe(ngqsucceeH@makVsound龙liXschв ahaoB(reu GCict蓲diaQseudo-patriots.fterv(aenturyfenefiritishulenndia,ts[17] I@@llslmemb܇THinduay(m1ansupbXbarri:ross]towarddepTuniMohammedwhrnone-fif opulahfulrrmyriadisdocialusichaZneromؒpcompelloXe衊mclaim4zpridPelfp(ismXo8њmmiXڒ(aЌ!tieb!geרopposН8forn70AFss TPzbsolut8ofXti8qli@ve SY mɥZ-pB !@vy"sad8iت.ǝǝh2e1erXVsacchtt ace!ϫpwXpim`"aneѺs|iؓ HabrpusthsecVItgainHarbitrqimoXШb"ӬAh@ru*ordinapeac(׵IeȰsx1s*"ߧٹanyCze@m`viez)exKize="-1">[20]fherovince.ndtsethodprocedureasqveeloemostloodless9nexpensiveossiblItBbeenlaimpthatBchiefeport0man,r.alaajp@Rai,sot8xtremist;u1؅Iۅ{,tyesuψgrnment0moxconsaith ac鉰irflueponZpeoplenat army,InomeɅQdefend0lluPregrenecityisonstitutionaloalingb@evil whsuchYHon.ZMorleZeec0arStateorndiaes]en_tmattero[.

TalЖQhibiI!assembtogerpoliticpur2disaffecparHcountrђespecially:induMohamanIeao.on8que$wisdompsa膰Wfr،eudHwagiorsgggggg">A8Qymɚ@i۠war{studFUnxrxiagaiXRiciᓰ7;Ho9Rthdraw8ffilizLRle$whi(V頠ouraged!body<VN^ulXmutuudbetwPtwoɷ`s#untuat72C rdurulaqu@ u!;(HؽX0Amerw`rСҟ؜ad0epxpconclusPtKiȐ '''Q"O! EqBW9A,
TɛhbskyesXly?>Bod's udgsx."oo22onggg#!ospyKa8vexyooBujAe@0Npbor,Bbr2ZiW2qs8fATxgheendjieto-dayPplPCb@1tu甈ur ȀfulnHtbts,¾idiosyncrڪnOaptdSaxoq@2itg輙inѹC੼<, eoseعppox@isubjecbhim.ȳooksqptpп"mi(Hindu,mt9Hkb8nP!BrahmhSudrakeQkubmHtoobey,shiptram脌nsibideclinesoearnnyPssonsfisdomr(them.nIprand,rahmadudrave radicablerejuhes,hichyyurse0thxtraordinaryondsc`ishCunyiel8genacity.Ԅdthiseople,r,in way,venoreXughty0PAnglo-Indian.

Tysituation ulldifficulHe0wIve<(tze="-1xa>[23]IalserAtǜ Bg:nhaanb0lRinflh(po8"[di𾪻laffaStضfIapYحXÎre0pPl)ow ol+educ8ChrpOKd:hkcshQxsocixIptitudrռlaiؿ;Iraȹb-Ab ([sةsqX9wiyexercp.es0PI8۠Bald Pi:ЩucrMcipȒ,ģ8oardProv(U!IrGֈܡZbezԼ!h 7-Brcfulhobserv corruz𱜃acquPd inknoepȣfa "sudd8 owal,n,Censionfheserivileges.

TheootIndia'sntncapacityorelf-governmsintellectual,utocialndoral.oneoubtsat9re!abilenough;manyelieve{텸䀨lophchpoweran9dome canqethicsRparedRenhanchpoich. 0؁(: dis[i wn ܂ryingЌ ce,hoxinflueypenetrat0ryx[26]Iыdmourgne] 8frded`reXpeoplAgɥzfroStyeZ驸ve#hrapio-da8)qtiduru`஠uryt褙udp:ry@aXeyeG7On/////(I8򖨥eIp]tn b< z5а0XC[fundHlacep9)(ewoulbidOOL7ON~g vela,rе,5-halfaopul{lwerahp6h@Sudra ѫhX wegod-gi fBish ,лnciprAir欨ow-c(zx;so-outQ3Ñӽ 8m!׊ӄ𱈄kleg!­vHjoرignif ]Hsayb0gru0׻׻׻׻׻רnesspro8pshҦٴgBmultiؙh1exvJ(sʼ[igiX!ftoftaris(e〛wi@ЯRyear@0owYJh)abi@rhoкbaȡR؜ihR|ؒJӁ&ukrem0ϭ˻`yGre ada*. Paxnn`b!٠gɰbo>W1YerE lsoAwadLߪhavi 4limi subjн.__\8__ؼu1 alkBelf-,Pa!exercؿs;rdȵ(u0nxaQyrip@`ҵ2cmaXni۫learykw" jP Theecentroposalf@eovernmـIndiaonlarg(LegislativeÄcilsndAcreatepmperiAdvisoryeveaypureStgraȁ*eoplllXatsHnsistwithcaram cyuBritish鄀Y.uth@hyρwhic{extrem(seny1Gain.erel∸Atrouble.ɅЁ`longous impasseώώώώώ">annotPmq lYyeffacerself.samhime,he̋preedorbsoluX-g,臒!Xssing,JG9lea\[29]CHAPTERITHEOMEFANYAITHS߫߫߫ڜVedьoay!gmb, for-fin H0YgnirSFnickeen; LetotWesternindulgeisearsbou3discomfort8dangeofxtropicalx. [32]Itll:͝opou)frxMaa,:missionary Pk. 螰argwide-awayHhusia(cȠqisme0s`pnsula;`aown,aundrd0op@qigreemdedt)oivxincipX8uSˡQS+yوj]worlЕL!Zʧ;@upkeepjarchhct8auty@Ь1woJ!jcovyqثǪǪ3ǪiftacreI GopXs)@Ȫ{ndmark姌ZasXcalm8igran0lockssix`fePlongInoParvexqP0fin1aba borh.may鱠iYskgTZevXaDravre8طola;yria:iľdmletcohzm tȫ[unrszle@bؒU0hisrpso-J_GGGGG@AuXxؼzfif8Ar (bgCapeon"ernpoalscextreTȍ:LCha),HY@rѿicPmIsȴSti`trolMONem">
[35]<Ȃfmlns:xhtml="http://www.w3.org/1999/">TheoldenilyanknMaduraemple$>Fouuriygo,ᒙaismsllcSInquisizorȖiabsorbQs yueљtooll;ha֛`n/jnow(bjecthe.Ώ!yᎭkS2MissaSoEngllaPlp@›/)3sratewif+g siveergya:spihualwm<ХޟdecrepHtypΤؐ?g8urXrmhIorkpn⠁eondȊwv#h8ProtxЭ'oل夷C9ittledom8׻׻׻">WXasHrKzͽWWT8WVoch@Qn impIcolossע+Utow,pQsmq!ful5peo0ship p8ayinشʪcPugues8xharm?sh)fVascoaama om¿hfir0nd--Cajne)God׊ˤfolly Ѩ~yDutHcamco[ǎHccupiirϊKdcr";tombIDto-cہQt`scrib*sidegf#hdeparfXndP@!‡z@eȗH>Buehixya8Hetݗ ߺJewsho qnokaP8ybbabrr𸈅DispୖŪ/ )era;hb. %m@berenfo٦tiȴـ@ٳma eȼXaXrvةai@xiXnoeЬmumagina[Ptsyn¿nkM٨9R NazxthJld.hs@ir-ϰdschoolroyboveah8ngpuHebrew,ag@Y ,Yeasi؉+(KtҜdoicKXBopH@ma1osY>hA Palꖃ1ardplaA 1Judaismmwi0fePicn!lwAcop">{Dcouyh y1aet9bkban`!) ePnanchtslФK?
LeavCochin,eass@o`sar9BombayPhichbeenalleȉ"Eyf,alsoGateway"woamesequypproprithiauulity.heXhardnor earth01morach!0lend.itsree@)madxceed0picturesqueymanystuA([40]PinHepeoplat 0` APeewi@S"TowPSice."ccor![b ef,$tooacriRca؈fi@inlu"bodicdea,rҀZyp)tꄰrecupZdjؓxh( sdYarowdhungrHЂ(a vul.υus٦)arffilthyird!arou1 edeap(atqfunertpP(slowwinupJeaghp`cxosԇ򋲠pɊTq@ipfro01iȅៀtak@LtȮ1BevericflesOvǭǭǭǭǭ">М@ZhXd9al¶onrepH(v&cifaIZor/Rthnic_ЬdoȺ.hlȸ@ŭPonruMohamؖfuh1rwelv{ur*`32fasylum3hadicbeUadv0PFk weap@hatmA8wo˯PeducgeӺZinfluXg덲ayo+xnumbxyeZۿnowcep lٗadaاe)EfolEibriH9&CEHiӟ9soxѡwrf hoێ0rn̷׷׷׷׷׷">I`tȽYs鷄f(laiד aaJainis,clhk ouddxm. nsatypHSa baiBrahAnii0xBYworship"!Victori趡s,"ipf-cipdriumph@o$pass!Batt`rfp.uccٸhx wabsorbiew8li*פicAHhu,nHIm躱ԯyn1,334,148IbL]2agnhk8objKsUshnty-twoOK">Xlead cXercl8life,Anwyf]devoZRrX˧h"8iR xtrXwisweep dH ptupins`ic?Xuw1gauzl'Э1d`roynutxormIӤɿBomb1 aspl|im,ren"Spesumnnuy.aimxtlXaog`ࡨښdQProughtereorsylumndare.tsvenaid,ɀnnotxyithowuchruth,hat(eymploytoomespenisۂBaiewQfurnishingod҂anyindsferminhiinfeslace.

[43]Tajahal,graTC>[ `oul(urabe1oPwPfro2rshnciAl&uCsy9suggQdvɤ謑ivilHdƲiؕhh`ᚸQ*lwell-fill1offtAԙHjusroy.ay“am0v{b(pstuβriouѝAb[ؠj%+.¦w!ewB϶,ikĹ0Z!NhЭusoleum62Ϫѧfavؐwif0Mumtaz-i-)EaxeؿB0wayȽ#ؾss "athذaGelfXY{aiuyvisetgȼunaka!b"dml8xemiPt9b뫀crib "coP(JTit@;inishjeMdeur͂"pNor)dcacwpanlʘXvXHunxrnA.:0w@˿Hpraisx%incomedificepyeꡪar,vh۷,eʨ(_exc(m"fRnQld!xٝXؽڼڵIehnJoHh0ightS]j4.owPeaйeed,uwFoawruelpni8rdeṨRʧ HJexhHsɿ`weal(sx@}chirtyalQrupees)[.feautyherewithombalm emory.ndsenttheausoleumst1inpresencefZlovelyhrine8hichthcases,thatiMumtaz-i-Mahal,Ҁ僡emperorimselfɄHiswe0Pmay怩exQsionSirdw Arnold'soeticancy,

>"Hpehearall,
[47]MarbleӒTaj /b__^bׇטׇׇׇׇ9ׇךǚNj777upa elhpownrournayibsHifxwordsrociraditps: "SayJesu`whPpeab(50橈lShidge.asou r,buiP.ԁٖr;vHts!utحthayer(fhi@snsPx__ϨϗW!nafe `Ҫ(7:pzhumaffec2domHha eachiHdrg;ҲXcloy1it.WWW>NHfHrFofouѢ0qgtPsquȵ8musjidMohammedan`rowdJship{lso,{wonderfulpecim[)combinarsimpi\AecalculȻoounthusiasKû؛fllahooߩߩߩߩߙ1ߩ߼ϼϼϩߩߩߩߩߩضȎ,graķGBNbosixhlXawD'yturalenius.ɞjqtkbSǔ1.ӚXPlлalqupjmemor`񖋑̾!noynaج8dinguishheMogdynasty,aapb dȯ0viewsympa,wiQt1+Du)lerHeoʣsXtwIHind@WmausuhKohin(diCIplaexhibyeara rigc:pcBstQoo\3onurrppairӴsn ,tie pPPia1739avadI8aack3(ҧand[fabulawealth,rriJown0ry">Delhic8a(ws' ЩRr8.ͩPhap3intؙ" a(.ƲŐXt jBrah@led)ܺɭ0`bc@`wconfxypxextravagpe8in,niHfirsexerc owѝv`omX7ȺXl8.э8gh2nr轸rТagzobлPzRiqvalua,[iremp8Jp؁l ̃6r c "!8erideu(yliv probablyoreplendidhan)tfnnarchsnationeforincetime.heirxtravagawasnboundedlovfiay(neverenurpass"tsla"`heeacockronbth@Delhiala܆Xsufficientaluo9debt"arbllls(richadorned[54]
El nilfromZcitf)ruiwhؐ"crowcelebratowknKutab-mi,ano9 (t0Ìint(Pupۑ0iahrigllyre8ktructupyainduem,9 cyicury񀈁pButpinvasussulma{conhنoMohamquamou  238eet#@f beauuworlٍBP. "1sculpcBifhc#thocolumTraj Rom C V8(is;hj!relȑCilitatriumps HHhhonJ`eePscrip"tWɍȔuhogni{pBgloSGohvirtux,srophet."5777cqmlns:xhtml="http://www.w3.org/1999/">Akbar'ombǮbbװװ7׆''wߦwwӞ"1󸀀mpx([roug1zmeiagreMxؿhalagoiABrshksorushI@rridaybitxE(enl(ACsο+"ggtO؄SxmupridK`ry一ashmg`wUreforcMaohRPci1blood.ߺߺ߷///>itJLassiȞJeemHm׭jism v𷐶"ty.qviZxtsA&fД+sliMrillhearذw`go ynatctIt0u,romLPcrahlg8xsrе^{bSopbottomXquYlegezspokeZOȎ%hu񼀻st?>elot(imoninobruddtȢ@ca(on کhxpo@far-of0la͖8ĆWClebrd "AsokaЍs8  emper,wxy-twoφʼ8 ț@4ConstaپGah9Qr`×ٚHɯ(on £hbeca(evȧopa5Aˇ/0Pxalwma(StP,Indiaas9miAl0xl;decreJhits)ncipteachinghdx埁˛uprockXpzs;PhĂ (c9pubPcѝp襳peopTi[DelhibazendpiscIervNyiis,rhapH6ful*Ńyhabefound.ndfheourteensokandictsnscribed,osttmculcateighrality,ႨsomefaoblPltruism.ortance,irisxprohibitionslaughterqanimalsrora0fice.ԁeco؂xقvisymalidnplanta9Hwelyroadsidthirzaommtobserveveryfthear9Rmutuxfes2s,peace-makingۍhumiliڇnin|݊rueappinXnirtuIll9s attoler2cosmopoBuddhiemperor,HongIwhichUmhould(shaȑmu(viay)u@ȕweyinjuncIRі`tcenturiesce.8haIi)yaiIndiaahous!Yxwqbsor@oew tindeasؐexiZsepara X To-da#srdlylyl=syetAbehoPphefar-off @Pjny =e,txPآissagbutainlpeupxeopXunknowponguex qmse`5bМheon;bYpriptybPXssiЂH㝠throwp %^YtowsP,Xr8yBrah@1>

[59]Kutab-minaDelhil[>g[>nspia7e`Ei0(t)mPyY09multitudƸ$uspm8,danakhahoHlishQ؝bQexehrurymayMamalgamMoham ۼun {moX<詔zmu@5etu|PJdrobserv.t0,1آmrSQ0Geasidh Yordy[slso,؊mselvoqi тeghlmoscaQ.o1`r(ӲP PperPJtfurharmywA:auxeREurope0sițg3Kmlns:xhtml="http://www.w3.org/1999/">CasheǴ,elhi|k>Thiseligion `peculiarly book..tasegeneratedntosiesfibliolatry.heireontainsheeachingsndermoЁfounder~aith;Jitresent;highestt8ard moralit8courage,:appealsalowX0tsturdyribe}northaqcall"Granth,"s l(spokenDahibpwhicheaianseRMr.‹"!at,yive aign arsonÎuniquxnydGoldTemp@largeusreceptacЌo8keepfew p9protecbyv,,苀remAorps!mueasy.

InXpartiar`2ߕynodoort,uteetncȎ`ekrayXisS0ȗ@dЃroXc9Xgodo؂cyrougJaercessPNanakharoph[66]Whi y,Xrtly(KhaoЩqtitus sgnmqdif i *sui(nnprIs.ȋQfi(ygʬwthy:l qSnumb+he9lifiansibiSbe77777ߌ؄irr@ac:heasXIy*񈼣bRټBenȲhx1ǚ xӸh0al`du8I`e@~b(srpeothaӮHi7żXnPdeJ hR/sȤ؁India">Fimmmrial,"KasiƼbuil`banknPxh$sțX6׺devHع+&saciHoPradi (icsue PӨcf(Ȱman!anyu@ n7y)plac acat(ȍw*o .oko8AAaϨWrori߄)glZspilgrimajtb`klidӔg,nI4`deaouls鳠Meccaoohadan`¡JerPl@;Jew`lGuIp#HEshЁٔ1bAP_XIhh@cap0ira ("QS ?")XJyDŽmHaIAipailwػh$g>@!ɑDYgaQup)leamaiAa@ڙ\idolܔu">B)b@g(mpsٲWyshabj0ghjtcrow(Aet|&exxmeirtydo"0deYHtraX inkey-Ýc@h(tricky0utdhy󃀀umptuouslyedyevoutilgrims.nneidef[68] TxsaddmowsomBbjmims (0Rcent JismaiburnAGhaut.Ԑrrranyodxdaily,a8wrappaшclP,)deposd Зy0fPۑa.חXihfeetpla0wxeart}agdrinkĘQ1,tgardHoximPAcorps1bȜQeam!ƕ1ti AF`pickń 醒dpon{woXnebEi*g9d !du1asheHsekzcfucoll,;nspnklɣRroremonp,pfQDafda(y)YyasecidakPrphup9Cownank\Bm@wnoptbeli0ب;dir؃okwȦ aw(iins`xmv8ɣalXst!ye0Prhm!>lmȬrRR.ehlثcdegradahsi9Chriayntil`i{"IELC(,"!hughaxghastsup0tiI~saw?.myЮaQdebadory3gro(quidioticCuls8B|>ûP!gtwظIod8i eo `bct//////">Iayh eȈ(X7)hstan{I`oa`yBuddhaKn8hhOne"sp#lo1⻈aH[faZ3inculc`"DoctWheel." be0iI{bh[؍ڻhldhVe@littb(rumsinquigazNbohS,ow90`y"eciJostupar0w9Pnow0h3Pty-thr躺diamj(sub70x uilȾylAJ:imblocksthiHȹlampgerron.ҐcYߵelrcriڸ@(iZAbr ȶo򻐿 ik ,jmXa (uؠaciY:,v(rollګғc1hipmeditsupTv+`lifHH darQо Lama Tib0*aw8upھb*ѽ"GBHNb(gnһPmaariHexcav:JsCnطj0cnnec `НᥨpPl dOAciAsokPHaaxgptu9hawardh Py.imagno cmqdDtemH2д38{acp1[M2ЫUY4ܒYxp鏥teacnXLl soqXyrh8 ugglxmu`9eroic`lf-denмXtedaw!him haciBo aya.OOa>[71] Inhisxtendedilgrimage,uringhicheaveou0ncienAdodern pressionsfeanyaiths<"dominated,rnow,people[lX,>comentooutnlyhoselera(fouȅiriginr?efugeZpopularitypenins,sQasinduism,emonolatry,uddhJainZorastria{qSik).׋also<(hreHostzCHAPTERIIBURMA,HEEAUTIFULl___YorHGwide(B ishmpiYAeŠhneed0r؎Q`lin (*xneamusiro‘جBengBurmLHtҚo˰YdoorwѬsrembarksp`sumptuYIrrawadyiboatرЅ1rthwardoQpK(earNcP𥡙oHleav)e[csȦeeصx0ًʬpQ habiPysepa9ȋIypAoXdi0tongues.erhapˆKre)OHfurheclimdmȨaa8ccuТyev(Ƭ1bӰbje4s-w)Hen`ahrepxl :poc YP۴c3WIza򚩕 Afourgnifii schnwh 0ng!aaH"9Pagodas."ZfirotcyafPhip ؠ9hXiw: xfar-fam0p¾)SchweyąHX`Yddmrnt[a`e䲀 ڣٔ⦉ukd;ڄiswwt4wvhwarmblemC:.זchhohri `thH ,a (some"d@ba")ԉݠᮨemoveGcepڿP0lac򿈐Qn Christianity,argedificesrhrectedhPheultitudeaneetoenublicorship.ninduism,emplHsklyaboof idol,ichAoutwardmblemLirodi nolaceorwr assjdudienceZBuddhZotveya,oainteri؈ypa(a@tik3pyramidEgypt,nivelstructure,utelongabellhapThighestrjicorrespondinghand |9,cal"hti," d1usuyHvX@ithioustalaeliquarya;򊨁PHsupposb(eptacaew0irsbЀH a!deedfʉ`i( 0eٓyfaatomygrem@waparvɈ، Cromiscudri9hroughalEast!

[75]SchweyėXnЗ,angoon>HК "aIthirnborldBAonpp`wayHɻl\ҙreotXd8rHsX觛 itsu(id9riumphPiaeۍG77777">gpculiaPronQho`8Sힵwho 0conocE(abhorBdo8qZdyQshoulx-dma{towdmleHaf BimmblinYӰPeguo}"y-twolongtsbxktar,,tfiguQzrsHYividuਪrBurmagݖKaıgChaxyqh(qde8m8Hu;DQbenoac(Acalmt@xBscan!D2nonalzacI魫m8safPHmatqRru؛}robPif,"Lik od,P">Olleݴaatn(boeenurs(ax1PpitPUp(Ü ifulͼalBVsrmi䣀anmenqb akprrrdyf:h0heiseansthenjoѰ) stu񃃄 _d.9t>

Itasnlywentyearsgohat(isartfeountryseizedBritishithoutloodshed,ndfooldissoluteingheebawmaderisonerr 1stupidnencedeport)Jtwo(ves,ondiahereyHllpeiraysetirem.pp Burmaahowever, oneweau9proXyi0߈hav aken銐8;peopleabundantsafi0rgime.͊alayَsosamArrakangodichlaim olcontem`aliesfddhaQth. imserazmageAccup H devgilsgold-leaf.t HstoJwoQcb@e`thus stexprσ! 捘CwahtA1pupH"acrody!lvrismdphxupshrindcalmP/Pelectric!>AnoioR11so-`lH"Fourȓ)FifPrLaw."АIiUibibPHs08fhsmy•arggranislab,[80]H`@Piful㰐om$ApracopublicޫbouquepflP`h8stoucho)K%̳piety.i.HlɨP,worshipmX^Romualggggg">Wthrougroyalardp^d8l(ZueIruc9l"nxsC,exqutrteak,긚1oi8dȸF ea, ghim˯wg0erbbstyXar(tzU rl؉ZIa̍wongڿK[Bee`a ڽ0awwWWWWWǥǥ1ǥưQmlns:xhtml="http://www.w3.org/1999/">ebaw's`y,6mb__^b''ߵ'$p2ir@p˸haruf(marked.ӗٻnl Q etii,lf-ciQmi\Huen pospsliظq@اs .ͳ3pppan)ocyboҜHpЅo)ownDknowswenЃaᠾhstae8loicol୙Y.tttnpprimitٿaele(ta;oPrx[XQ,lat詓ppaKadorP1+silkvartstifan šbsȪ c" S8XE ." dlumsuncouY܃*`Acompbxinfe`eб(Rl!HB'E1bbs isyp`onPa90doxnohur(@aewuropН8ladi3ab¿Мؿbfr`om'$Ċ@HewY.ΰpJqssum9a("ـ"amilyHbu@cJ2d!arȊlqlorm]uppor˾nhpuponerndustry,leverness,ndepe(nce.ertainlyuddhismasroduced,Hanyespect)ig!typefohoodhaHh.[84]
AnotaRlifeBurmasne)tstantcaptivatewhoohYeromndia.Ɂsl9frerammelfstTilterȂ*up@allngs1/idxme t:poinrob`ocial much̃@wee`beauul9sgrePGaveheattackeerahicxymsglaoKrfaithadbprimienHy.ύrejoic)Bempl@ˋpublic Xaywٗommx( drinkihouseRKeoforshquiȋc8ouqyou&disturbqilhonshipjma8convasu.wwwwww>T9whiimpbervhrivisitiumphworachiȉ issaryfdug"ll0urywwwwwpknowworkYsuffeultinbq8pph`R,doniudson.ȠЕp⟹P@oulXAinfluaxpoɓiegggggem@cBM+ﰈshadowby''$5'&Pnumb(suc`bodYaڲhSnd.h̔timrXsPʊP:rk8ma2aeepqunq>BlbemosJ+@HXculih-b:counKarenhȒl"ft٫ɍQgun:̪춠l W,ˆyjtwollUowedepthbarѶ hguagducwrngseqRyno0a8H.+2nȄhzradɻ ѳgenQbibȊ+lؠպsaeǸSpiȧ`9r#W鷸oHmѽGobiappe8Q"FB"88dpX;ƃIrece(Cas8R҇*@ng-y̶X.ƈ[H!warXs8^ yNXcospe8 ,ilСϡͿnnXS̸(,X(hund ift#ɅertX''#6'&׽׽׽׽׽>ɞҼHmean˼GB#E!wispst0smhipdrxs4hselseӯEм8"alA ir)mDfinancialurd8ߠ1igirhtituٿalwaysuick,n0ydJ( }claimpurs9xrطxviewextrept8brvellself-outgoosɡhXP'ski RoQU*mp@apchurHz۲$30,000K+iYgl2ramadegnmqadjXss-roomThrbungwyuild9valuʿ so8Uo8proHȳpe`8b+ve8eȱ}argheolog@emX8BoYstuȦperraining.ophe퀈tenancefis,g8,oseoXKarenhristiansladlymp!uponymselvesamitaxxndavesweeton[87]
TheeopleeiocialcasoowFydractinousicl. ЁaSre(eeadSktostern .it錨stonishBoar8well;s&tu ev(derhlo(quartetttublEuropefunoxaa)s!9tycps.Ʌbverbi9aaqkday.okY8manyoiy8ovemePamo9ЖAךi8KoӔYt auniqueiguН:xyHt.esȜБ"Moody"qBurmaJbutelli ate.hab@Yysld,HPwife[`onchild;findcomїsleolatryturYBuddmreliepretirauntXbecameni:PdLTde0scca(Phipoffng@f/Huilwoagodq2țerBhysofd˗0n 1890w)apt F,nX0aryfolhHתת8תbraxIwpy2cptromrnD`0shvXag8hichwumbsŃIHPinfluHhYmaz8ۦضQuȶ(suptiushjrwe">regtPɰoغ(pAa`Gospel;@])-hl򴱻ord'bla ce⿱@gpurًaOwork9Q1alfatqucybXow-ר[pp0K@ex`:le $130,000view܁`ceepQÊ,sum$bul.r.WAkbyfxdi(ߖЄ}Chr]m.ockjhѫ+*jἩ0thXaQ[."judgrPnȭsuiet Eɸfriendans$wi8dmin XaЪob0hXcchurcheHschoolst-sHtogHooptu'Цݣy3ya[aeam-launUcon8ceWWT9WWoi)sidfrx-m4b˅air8hmissfad(ʹZx@sutomobili|sm诙긹wriIm niquiuxdiht2ra iRango0JtIburbguidڌ¡auur!tZiwAdeinkbeenjoy+pe80b~ Burma!tXЪ 3 tinxhre1mplifPצm gagHprotX`R 䭙cr8hеldmsmZѯE:pisodBArɇhsaadephbarisohiv8ci0difTXof䢁1sduپ2baptynhrtX ih| wQna PO`j/+!Bye0Jsai&Sзʦracteristicsfhistrangeanre humilityndunselfishness!

The˃Hns,ithlPeirowlibarouqtecedent!excellteriaoorkpon(nd[90]CHAPTERVTHEINDUASTEY0M|zd "ce" dromjL8erm Iushichgnifipurbreed.tusby֏oaamaFfow-Portuguesdvurerf)I0e0goy` southwHoI{beghdycYreictXpeople. expȆ㉣remarkabThelH6ger;ubsequgenerofor`Englp-speakyKaxadoptitoxappropptd䠚uniy@mԆvail0ovP.oɈ|stoDld,ere``MucmpXym.orwy-fqhtrolifenearlne-sixP`Ȏ(O"cou, Jhab@n,la0dYn@(s`phithicدnēguildvar+orhiz.utTqonH82ypicyʕ;HsP!)mIxhoadictгXdetp,el#hipj\rp12!Pimxe+y+shoubemba|ܐdecoHz`Xe͡6CT xLobybrouhsarulٳHiobedienc4\aHo.ҥn;Hinduefçtdomain;2 xdrawa,8enc{nal(nHorutsi 'ȳJЮookZcrSceadydu(*(iaga؊er,Қaxy(incsmse8absolute(harmHoW虊norkirulp[bals0i虘8wiPx Dlhy!agrbung-gnPH0doоbn8ܿiPp+exerci{!expinatyran.3

Iјgcubj ZupuXrؿdeb. 0@VcwunknowSXetyYday)m 0ceL𵓤s!A yetw`d`ow08mechPXvisQXgrewtBٷଠ½ԁ詰lawgHManHab(wwigopa:JЃx񂘷$Ҷ׫9ccomp0IBYelfpǰco)e8lrjd.b݇[0ba(/R BrahtribhjpboѤP .GGGwwwrunٹWvarnaհ`h"colour."Ȯx⮸suggvIxd1yrahbackպ+h9-p8QA[skihfir8urofheairryansromnorthwestettledown,tslaimedxnwernioHofcountry.heyraduallyingand termarri0withdark-skinnDravidianaboriginalpula,natural[94]varnamayrrQ؉grec`P.

< ght="1em/h> diȟory=Hind`referzr8sdmirabhsibquؚ@ssfyty-9@͗votec9o-daBrahmⓚirgo2ކiaxyC1oXwamXiysp裩xE; us"sai augproceoubhPmhiwarli royKsriyax011shoul8Q ng,ciVaisya,th🠪ٮmenASudr?PeetxY@*primٗdi__\5__througyʏmut8rB`mosciific0ud&soJv qreXdiscar\g0myxcHex@ȇP0nicI(cHIubject{avIщyo0j 9pȋBisЋarPa(el2;npomecthno@paHLduco(BdY]&oٿBpRax0sHɭxki!cr1.םrnvx=vaic)Jemphollows:wwwwww>()1ReioPбpi>TYgi6Į聍influ:do`#=cIma e2lJunscrupups^80olarget0i٬hAnr8werfulpor:aIXpetjownmac`mo뵐ofspiup9aZismrecog ppZm@1r8iʨWon,6whii0pispu Ja!tindJbhQrڥ̽aɠY!` quon:admiX0I俣{.pdayTubept"7@dyPltwȩxqanyU1Π0terhoo_b epaѿHt}wbe@fpd"Ip@s),Ϊy;ں2trhrphpos[;hol,xCbrᒺregula@,ht sRhago@᧦єtixع0lA2Rye Ap7xwhoscpinju`" kencpemQ#m8c="1em">
(b) PTheribal Xory.Moreover,here)manyboriginteshichntHdanksfinduism0roughformationnewastes.r.isley,nRCensuZ1901,efersouch. (Seeol.,. 521).Qyraduallandonirl8coms up؄pathbt[97],"❈empA޾Bs{oll,onotia@trom[z"> ,w׭visoocaYȷs,w|1lsX< twemb.ƭh٭ @c:1Vtڷ1ccou marg f(dowPXؕxGhe`;aؿbeggcau@ab nmlcoX˄RМcPۼ0lȟX!zBfrequlobyd_ڢhwsP鸑adop NJ "m)oH.nitQsohib˴WScludhi:ľȱ`acѾȼunryeen0cK#1''''''#d'pOHp:WRAPregarell8hipmtHpq+M 9lificPulYٵmoXimlx QpdywasPitXh󺙤%yorahmaKsriya,aisASudrx!MlechhAut,b`wj(a_Zy woAhusbhZrtisn.illiamЂlJohn˩,ddayJ0sӸhX(urvivalnglafشvarnasManuh(Censh1881.)֟ese8qP<مZwhichfoɺ-dYjoropulzpǂsubsidpһxrغ ܯgdx`ononYareegradedyollowinghelough.nd`isrnumberf s,ntroduckmodernivilization,hichaveoteteenouch+castey0m,˄enterprisAyouth!diffntqHinduocietyhwieagess#h leXrfacitequallruat:funcalype develop1spread mrapidhanXyi.Ɉ0town)Madurahewamfromwer,penaemuner8؍x:manu1uhhfireworkThetsAgan[100] (e) PHßoryi>AccorMH'sDharmaӴ0ra1PH9lpBv(ZxoXt(max ɱPnea̱+b"breeaIo(lawOOM1OOtwy-fc uragHa8aoff@4un\aoxhBa!)ݥu hEpne0 xVremx۴ٌhgXɿPrde"T<dor@ywisdП!ce2utr؉ڲ0Hsyimpqbثeci:(qubas`7orxd5 x.eGphPdoubtlٓ`rtael:boˬ=stu 7.׭ab-(c i@ulam Dravidi,cxlyʾѭPywhi3 origoPscegenMi hdBh0;soxaahPaselvclaiҽo요S0gggggg"Hunexhp[rmbXAgamٻѣ#st"too3iimmhxQ`val.ϻsou@Gѿxed.Ӻ8,`k 8tah!Q i2aphey2`fGux8ll#,Q >hЬmo:z賰;ôack2ƪvndeɪ׻׻׻׻׻>Iju0astKq[p8auy٤xhI ,Y¹P0ٺڷYvydegefficiencXRpuc0e,beominY usp8![@ytpy9lM-duc{reȼQccup뫚had0rk08e,nflu al to-dayhanverefore.

IIWehallextonsidtheariousharacicsranifestatifaste.ԁsyXms ylexiblene;ndetts߂areiic9amenlarxcountry.erhapsbolear0describes0owerneahquotetengthh`we판r.isley'apital^aphraUn BlackwoodMagazine,8dec8go. "Lus,"Xrites, "imaggt􆚋Smi`...1whichbubtnuancesysocimtdechav)en `[103] Mr.isleyightaveddedonsiderablyoheseestrictindimitawithoutxhangatalogue.

fxorigo)perpetu.o(harac*sayasway;ًS,<0tize="-18a>[106]< H="1em/> NJTW$wn.geu 0y|`Fؾ`s:bоP bfow- UcircumďP-dty8powsxctat_xmetimbeyohg.ήmy7ıeR;*spuloAܼa0cYbop8 dlexQcooSh?@foosuXfr@bjxollu˸ ,empntыr[cfu1guardcӴo9}oȿSwhh𪈾شhailw8 Cccid:T'h-p,xʹsg8:s@smi0pЁyplwx8iiȜtxYberusaiAҽ`cy,anaahibCawnȦwablQ葈8IvioǹeظassacȴzinnocEnglish;ˑdrikgt͏y;Pdrup9*?eo0vpim*trYwouhahb aկGcatd00fut@iS9fiat@ !brbaq8AdoubtsdК+??l.x@hXbodпc˺)kifi:(e`ٹZJUsh¶Uls81 subjectedoheeremoniallyollutinguchfutsiders.

Thisrgency Xincreas@byBfactatiffntastesroscriberticldiet.ԆhSivar,o-ced,xetri vegetariansndillavebsoePnoommunionhooQtheat- ,ven8oughrlatayeloJ艈)emselves.͂YanyiXabominatkm.ύresp0abl+2nXchicky,suttonx0ryewrk,hiXpermittembabeef.oЎregardgordoxohorror凃kȓa)Qڔow,@[109]t0 b-h;:(%NP8approaaami} }rtisBbwi ӃslswXy-fAfee!f;ltivato8 *;Bf-$PhpsixeLik+PalHle9ЇI-zpHqIaaPuntill8expecqleaX9w箒xb+Mr@ir@nu:ed1pίPȽ `cZ!bsti$s𳰁)@yeȾhٌɨP0Ejudgأsmi`!if̾d8a'-up@aŽ[nsЁ(Ͱcɢfy:su0Xi[112] Occuplh@bae8wavreadyeؓmode2srad`roncrih AlNirembers;ysoithhctisaity,ohib0yCkPaork!dSPosee݆oh*socisp膹hassrciiê݈oyea,reexpeB٥Y}qtool+hodbxrowd.ϧДwhccoaАPPyam@diHePa (hc hch.nchȠ@claflpimarketTepouldxزh;labp (liv)IsuggIakex3 bfurmQecexҸY8hxZhozimp4@Eab("-6dn!YfelpAbgroupbetwupperOOM3OOnxm((;Dg ȇgkysty(arPbpxmsҐ bѴpobltPlap1IT0؂lmbsu bec1arpxXG^usIcotȰZa҂&silk-,{9jar𙕻˪㠱ol8ؚomeNo;jgeܫ눬gйzv𥬛d". "hcom:`"(@d.Hw"arn0t#oba*oadefiص*Kthߚ۬be-ѳIendռ??????>TBf8jonnubazvЀntиȄtal<0fHpxeXtnɮa.™adssP)"fuHjssuorȻcerta8loc𽻤Яـcircum .čnI3re@observi xjod0|plaxpilgrims@AiriɅs/ߓ*a2orBǪǪ4ǪǸlimnIset2rd9Șauwҹ d1do KdпxlegislSBGGGGGG">ArRѽpeculiarAtotemicȁJ(rer zrڱdiscoeh"A3bsocyxm sho AHpuxLDravi0nxhar`bod2taÇLea@ȹrokupqoXnumbgsept`EaHnaYxnѨee,lant,romeaterialbjecnaturrrtific,hichhembersfxateptXerohibitedromilling,atBcutKburnarry"us[tc." (Seeensu:1901,ol.I,p. 530-535.)

Mr...razer,n"Fortnlyeview,ivesJfollowescriptioneotem: "ASsclasʋ-phen0na_Zsmostommon(apecianimal(rsbetweenLandimsel{savageelieЄertaintteelh8exists.hleadtobs:k˄HftappXbedždžurГgroupponsknIny[115]IbsorbɥDravidiaibes,rahmHroƗicxlȚHincorporpoZca.y 9 ideXfi zJJhakpuliarityibeYe*ntr!vend:MArysHindu.h2cerIIA(׽jްjݻ@:accep`gjhospl.Φ š=se0Qer(".Ȩ*boycoHtly`c1txPdqsy8ԤonskymкK% racParbour@avQBN8wiiPIvһ[iomyyŸ0ejOshelxroofIfood.Ͱow!seXڊyxbbtؒQad omChriaH7 ahn$p ҵpectabD 8l(b`\ؼpnpksЭ8c1mopjbrؗm(ckalHh.udᇘoHy Hpporbid3fami)o6⿨g0X@Ǻorsel#2(a w`siinauguePlo Y(ersݾ;asqQy(X?j meansoeutcastsamily;ndowanheyndure`at?arnoteartoyalɁstfirPrs?Ӏonflictuhonoronths.neightlyzt erLirXmpels(rdefy\ext,jeatingithRdro ₉aniy8h,uto88 rIhimremnanHliXhomeessfromhich0adenIofIHi9psalaleafbehduse!

Then,Qcourse,e3nubib`weby0memb}prohibitedgivanychildrHmarriagoshihold.ԓKwhlie0is[118]Amiyrg@z膤JϨrecr0@ servFinstaȎabarwasᨘhd8A0ʙno`ngerAmrOK01po bP zhwern,HlwaysppѨx+ariexznndialqs·óiПo oȂ|c!`ctonI amildoٶaKHer0mÈSWQ.ͅosCOൣZsould,|circumhowȺz܉thu8`񮠫qowq.9>Adg inffur, le9soi*tic@0ve.ӹXl𜥳TdiȰKF5xmitelpladiaE0[nx(xRicPmel:chardy8i`8ٯ9nY[ܒ(iJHlݼlXccurssyxm,[piulCa9///////Ӥxalh ecedIuubp1mineZfKcpprayasttaj1ВI*usu؋ppli@punishⰺhqhaKr cڼprHl8usshstudykrtl raacl)Icmoni2ha2s˳`ؼPWexcl@@ſdehQJ,Mlech|qoughhapsigoroharРCChobrique0"black@vils,"o,@pre4twith rп艧pollȺRin.ȘӎJ^nPss;deba!vdefPtbaco,ngulfs''$20'&[121]naVxpihmntstiup\lIn1mcHuri(dark,indusPybeё:oubmФZumh.ere1produc(c@aAXtsupHf-trljPmȐPjectrHtHxiwoutleigor8tye8w-seek )abolishNףquypul0tJꀝceason@s avoidEpenal(bound!jris)ri;Peignlss\"e(turwahervam.ӓӤRk(8Rtᦨ*sPsfieZy(BcR@,y#gitpl8(xs`^g8QDCygc蚶phypoc+`!"ɻPl taYe;in,AsD!t׫׫2׫״9!y(owj|majar if6e8HommuUrg.hЧcmfroؙopxwhS`doubmeȅI!Is i"onour"!

π2
CHAPTERTHEINDUASTEY0M (xued)'"Iggg> ay gh[˾!ocпupE,lXmembmanifold.OOO>FlyXPH8!r d8mini`rouldn;s.«n-StP(P!chInstl`pq@xboA2whea,s:violRsHicjun py`dinflirjieatfuȆvariounYR lcиFp khفuwoonuAnXdiamporXi92jmoaVnuvú+ju`dISupo0SankAriSom-assuexercyPapaoRmat$.su,we, ho%rg0z;dhHct`14wulIJspet `r8iўHDafi(sort,ithllasesfItenfringement*intwnembership.tayeonublicss8lyhenmalereresandaveoice;rhedpanchayat,councilfive,:sitjudguponM=rightnalction.hisatteribu逘QmocommXSouIndia,Ё8har0yۆ1spirȇ1methodBl.

TheHiau"our|(icHadequaasuremov`fromDŽDŽDŽDŽDŽ">Oh+Ȋa aybon2PestrrehВ^؇;Zganiza,speci`!newxaccepted[puPt pen+thatlongpoH,evitaeaexpulsy?ostPshssul!*convYI(Chri@tyMohammed sm.ut{no8sn`rssuld(shmasuppos+sh seaǀowmȘpvӓ rbod(fward,枨inst ,peopeasiiYwnatu0carrm(tšicomHb荩[125]dxacto^OOM6ONWWWWWW>M 9a`dxlsoЦTsy8tip Jia0OfrYapplqfJ`:-reriagesulkٜz9r!;8y (obc@!akuYpselYvirgXwif y@Yal)@ ʻll8󋔼8,S??????">Beef-e87sXnJmembHZpectabwou80oKyetr.ʯ0PHRamSwamy,ivekaha9Тt`ic`qص9tefulA`fY i⋫gtsh#hhHhgradu(4ordl0-j&sacrHf  jHexempxxe(limiľrEvul`m(r(nsmu1.sɞrivilegH@ntdom?'''''">IIkAnner,ta܍@un0irsi YppT+r1y[;sanxpsx;ڂftropic8se="-1">[127]either@cessaryoronduciveoealth.ndet ariahutcastascruplesn0isatter.t pindeedruhaeould mtoȄaXw anx;illHsitatBpoison ghbour's le,mayrebyenough@rrieat.ƈ@Y ofdeadvxagereerquiЁ;8dAup`finguchenjoysBonlyenty.ˆ0ȌIorHubovinexdi,f؆ssamestrictpvehemXtabooed.

Punish9also1ltse[seenPoshb0ooookА,8e"behriaHMohammedaKsiwof`lowИ mselfR, Hfar"yspir0R;certaphSYؘ!embpXxhadхAang(hfpprepd,1pollutP.enc蛱whi`Aeek8ivacavoiSgaz"`urQmiime">Offici{ae@’`ou%-classudra_prohib0rahm1(l *o"twiborn"<<0ze128߫ߡqc@h!ijQrawxci1c`uXadH[irYirPi >AJЦ(oupp 𭨙HHT s2nloJhidonsequBQimmortyjoooooo">chard฿Hmxy syowDjqBctena,sevHpV`earpGGGGGG">Geneزspeag踓s{au`yexercisش;0emonialbservJso ps௸violpdHtpurehical{b@acqyrlev;vidu͠@r`qcts; to0hihonouJcomm{0rganicif`mpai( uctsl8ljHpnedhri(qXssw)Îdinflsc sstavZf`igyleaswZbhehpoXAf(ndlQ.ɢ3of@׫׫9׫׏I,am 8ʟX8epoguRmPf˖8ghiejuncQYjyebH̀˒ort mjcil 0mchȼunukȻ>OsciplinPlmaЮ8tCitPQpyHQse0ȃaxed+monHn_h2cer">V[130]sionfomeatxaleatures,rigilyonnecteditht,hichavexanc oheyriads0o!submititseigverm.utQisxceedingdifficultdiscat:llencelmmend脤peopleth0land.or䅣writsostrivedefȇ*systemssistsnakȃ}y.odernrahman;byogXraaBtacharya (see "Hinduaps ӌ`s,"p. 1-10)n`onq@fighpubj0؆X(obserz"legislbKeisywasalXaAnot{brabounbetweXisocdlpnrindia,0 rrpobЋQmi BxeProupfohordwereppounTcountryromiX@."LremodayHweaknesكg2hrenYheir  a,H؊nAilita erllGb5,Corganizrc bt(gpfidbhaspo،8ng.ɒ``+jienteffwcencreiobs7heterealso2obably x_1o(!g3Ayille鰘ȯIamP8coh!rgPr$raiyonY8 Րxgirllay3myJh2aexn䢠.ԓstoI:bѯ1vilڢHwoڹsu air-ظ1pMr.Ӥ񾁽QsζPdhstudFor,@lǴh"nѤ(hd0sjqshame"cPrefX!Tribܹ3").å𦘴Q,QbeaVlif:to-Єl ulPA9wXamB]@inWfuPX(compellronPg`spHlp`__\2_^>0ifirpl0 s `Qnxcع?o8&2nonXмɣKr;pnimosPح௿٫ٛAumberTq,Xal8.hi,SudrIck؏@mac"twiborn,0my傤selv @end*pumpQt,hm`H̽`yri<3ab0{R|ZSر9feelza i0о(pYewІwlo0 lмYvhAϺϺϺϺϺϖalsoowmppO1l@nt:wayp~XݣήheHpan'@u¨, embrѨ`9bp.hllow-bediffic8{8ngpperU޴ofHDque@sk蠁"Imy?"f,kLx(ol@dscieʆxim"p鮜㰑."worish),treeлȰwn aduraRTme}3~w8y-f 8hϹ PtrangH*09ereheickenedndasarritoublicest-house.utheneronditionecamxeri@rnolativeshastendAx(9support,)p(oHin8t9treerlaylplessthaysraHsunshinHundreofeoawbdyinggoniPyassbyur thos;;`0hearfympathyen ; not؆anger?ilefanmXcan0app:ay third,dem(ownficʏbe:backFWqlyfterwa9.e ( oughɄp090o  familiaithɒHlifenow(si,dai honِwofulmitxonsichimpsp@huЍN.

CalsgradXuaabour.ԕqo0#panyrahq folliplYon(pp@⎫ruTh uPers. taďlJbXtoil,owevhom`bmonean;4sinZalR$$򏊖deem aKg,difs0eirbabjectz ss,[134]MPo@,mxsiKcoa0Ici cohry.o jhrave@anYtahoڦ9rpve:tۨ)ittHhopOOdinguismselv)IbB'GrB؍@,0 Xr)eА0ominH">3s easɗag:8ula_aeȽ0"toom5oois"Q"XawaFnoX19M\Hpcr HѭɎylټ set@(+opiStayseek'noo`HdhQcurihbeأRasy+adRso[o ɛsespЕ@enuPfe patic?#Пe0tcknowledg!aZdcȊr pkmublicz3Nc)Мf-)alow"umpha}smnibuiupaщr:Sy m/////eکۥfo،s1tenemZ H(.ԅۼrif*$mitu׶6 輥sser,p(0cr򠊞lifursu)appafo.WY˞|Nchie@uPjcrush;ic mwBabebV&`e@frohmeط,w~XnkKk9rfup`r`hi f,*//-6/. theyonsideroe 8stndacXccording! dictatesfcience;tasarpenubmission castomina.0isunblushReacJStras@atbedڂTfulfilmen(futySsummumonumr@lifSomnipotو!y 6armheaareotefy.ȅwempellelooknndia-daypi@saddYspecleabjpanhooworlxknown.ԍ9osho,kwriter, vptimЍry4raiioutslowpQta Ho0ty,modifficulcd0ouragbsinert%+nespeopmselves0hrough bitxperȉuylearndoPpfoPdividual2ssi gain gc, 8]ڗ8ُrebHтeirTቢvermlyuttʔ@쌠ada@eockGl)emRop`umufirHrem despaPwhich@maighincubus.

<="1em"> N mubewitheducdlQ›BxhundPousse[137]I8@alsRer-moRlHфfoxevil.l.hre-days񁛽@margprohiLidtem)wPexcntc.idZexisa`rg9supporipetubq@uPRݿ|uls^Htu zso0bex ng_">A @orgzaB³Px+ispih reasXromuҶ@mDcmLpoinA ucȤpcQ࿨Kl(t0`veile %askZiautwconIjH''&8''m 8i@`XdHR)fa;逐Ʉ fuon.ϩ˜;hJ (unmharac[t8nteob„,88nxewnrr zꊈhkelhmsw8ie{beenoopИja*Xad9psh*Awж(@nIri uo&indunpta9ragobur2f! dpkP9rQahrກoK<`do̥dKH謀Jword`@XsymrtivxpeoȒqxdom@Yelrob,aPhoo;mak nobilm*Agdiffɓ Bap{I0Arah1ghdescrixLjŷ(a "vЇ̼(am."iis߾߾VI[139]oreefiancendiolationfasteuleszfrequeysuevidesthepeedyerminvitseign anyrousime.

Ita oong3oHHmelyisountr0hPHinduccepPitithout xoning;*Ibecome+󀘊0toim,ene sitybe.ׄwouldtolerabarksHaׄ0erner ؅aatpourse.ԁ rankfileRs,ceasf. on8ordlifeZhichЅ8versantmay1iyrgumsprovHcruels@lItilllЈ&symnYknowsowliP carxobey">Alreaseen,mificjқsnrɇauxrgeXal(-dyor͛1reӏe cialQVishnut酩followhyep.gtuddha,1 c0,oo;b8ch,z`wnur!Il8nniRon-basis.8"ymlccumbdem#Zagzpِbser0'1 adevoRor.<>T9(xꭑspi@jdesd?"subgq0h"lӰvehnt inocu88ʮvir yarias⪀don13˪}۳dTisQf(Бwretccsexclus6rigiŔnarr1hp{'''߶''EYshbЉZJungPeopSIndia{>Prot!?)-d ncfo۞ward tweJeЈaҽҼ11fꪮcau0sobecepYep-roPtiedyhousandamparts ipresenhmoreiscouragemoehristianorkerX`allrbstaclesombined.venuddhismRJain`,formfhichasZanciprotestg@Hinduaste,avoft-timaaysubtldamningity`m.Ʌ8engal, numbوknownbe+lyeeRtmuniti (seensus 1901,ol@I,. 523).[144] However,otwith`nd:grow@vacmarvellenacity*proug0lȏғ(qHBsidecad9Еgrip pcert`relaxy manyysȂasperKse.''''''>ItpyntruthfulbHaiyaC}multipliJoneEsuhargH>TFoѝ)visios alreadyo0XputatH.Ԟ0populun soSminusecedifioptyxels؂XbixXmada)opМI9 la0Twarmoc`ldZs1l0bex(possibX aus6d@trmodereapflik9nnápeXpaJbxcessa redudbdum;spiontsQilKolerabl*X0yخ!inhabixIa/aXHeruéZPPcpjcarrm">Epatpou0P XЃc(ianim(zvicHn`ndepޑu{rg;5ro:4\ub)e-ͤpwaȲnl[hh,*hildr^ Atobj Yo@piiedl`BIli0gCxl9@driڙur,bس޾mip@bmeۆ 3fame슥yw!now蕛,ciyBengalrestrXPa˶Ѣ gno.Lepleغ(joyrxahotel app`pѳX(1ҿlib蹈Madra wHm81nrubl@BrahlawyoHtogeom 𤰔X-kȎHaurHmQ@81K|hhsociety,Pooө3ou|xrishrform"Liebig'sxef-extr(,"іl١Jffe@mhobѻ@upi`c"t."ߪߪߪߪߪ> B٨=rapizhonjxRanyd|l@wwwwww">HjirstlacbzbȷXexle 6howervbo 9heo,ro-ȾdHribuy[2GP"maetoupolluk9"sUoflaµgA`a reHrxBXcultuM.Ȧ!Qs WXfreeHirks'HiqJX lh,asurn0 0tngغؠ_YаammYPabpиhYvIp8ilegdenHinduAjt@hunBо`fxayridK`impor𘑭wmeetŲ0ishriendsponinesfocialquality;uthiseillindoempossiblepartom idefiancecasteules;or,txmanYWest commcupIf脠boardreessentacondition truhi+iHmacy.huslifAingainɂxa aكntebukȅnarrowiaurdist }B-riddeneople,0causX!vealmdifferbetterayYliv.

NorQmHly[newypnon-[147]Connpٖmosubtĥ ag8A!fouma;UdHdȯ sexclus1"chiefo;rail@8xhmiǬsoctXusproclaimko@pGs[}Lhme@px0eg+werfuB1"irwire" or8av(mselfجq0uraa ؊ eekyowlDit8m(afelgernviki"sDZDZDZDZDZDZexµsclXMill}you`n#mؑAgɺMq siarYvȻdob`gnvиQ">Yg`rnm`p@sgPt)itif0Pofpe@poshontistri8ЂYڀcm9tfxce9t0xHgn ACindepenu ¨ ultXharacO@(ouaffairJsunce9ْuܮx0y٨ ?#sʍhemoluunknR؄]spp//////*Av@m氐n؟Ԝfhpo)cra ٛixsuxa:n rt.ee0shul |hprH@꿙begΥnndariahhadqualightseforeheaw.o-dayyl8ecognizjusticefisexpectt.

Finy,Zadvent9Chrianitwithower,ntoćha`roueweath-kne0Pcasteupremacy.eveenatndHonver0ab ono`rPomertions#gr8facil؃ 1dos*.ɌHrooxunkepes=soieiraturButeotx2growtrongagainÄusedbLjmmu[150]5W1ȧ4zregen`ranspg+.ȧ(bessagPldmferhoLz؀f.ˣ owxPs8l9}PeadPLontrpM(mȡ)accepgcqliMbaptd;hcantbliYk SߌܨPmo(tlg㩸g@pportгoooooo">I¶wilh`runnth cJiMc`ishiituԇٱ`ʙAcipit01flisu𒔶n_ex(1ǼǼǼǼǼ> ex(yeLw`ld8omhedxhhaa3YyH3ᤡnxsxbquAغJpassjuȒٽΌcumbbrief 奠Jx0>shtriumpdϯ(aXPjlXs q y as08, idsu)߅dDE!oci;xăRWشёSar(,toAt Gl uPe "Ys"ˍQpl i:Alq-csy"c!err@(zf)zalso?fife ouS&vshptire*'@xoy'n0uh,lwi`ul;PcPIs,epiculabncrUidoub sreakn]7future. '!i`6glormrexali___' 2'
CHAPTERITHEHAGAVADITAHINDUIBLEԻ___>BhagavadǷ (tsyd "SɣAdorab0OneDxneay")꿡regard9g@Hiacrlias (IfewKqu8)nau#guagQelevJhndѿxmirS@s,Lwp@s">Educ(dusroudlylaimortuperiorityollacredooksftheraiths.

Of ancientrahmanicalingsisX-daheostishemberthat.ԁRigedapreson aantiquariannte0tCUpshads,hichrefountainheadHinduhoudhilosophy,qtext-ہAtreasure-sezކametaHsic s.utDivinẻ@oll`HlikemenAwernult,Yconservative ditpEasar菰doctr9rrXy:evotion.[153]Ihunrsyecogn)xeInoS wieldparginfluencth؇reiiftw irmillz\;ńuc(moworthbeBibleslohamsҪXYGospelS Mark">qdat8gS`( udisPedB`au )would0backif`YB.C.y竸8Ar@@ens?ta,*JWVRsm)par8X45sclusrroۋ`bosi)irrqw p")!soxnOLO3poet߄ѻ flicetweH5bȹAȞfahy P`Kaurpetkdom Hp@,eamؿiXDelhi?׺׺׺׺יӭa@c)ildy0PouQraeaiVب3attle-fKurHe"BCxblown@raculQhlض`bpPdY)s8ؼ{c@iodraby@ ses.ϩeaav(ponal )gn.rjunДo`\f)0XL5Ja xyPo@HIXacHyehimzenЯasخ(uYty.ȝ@au`(ɉmysH8enemoks{YkY0opposIkȁqPcy`n scienpndIrtHimpul"IsѮht,ȡtYsyax 9(g9o 0trotfr!rel"s;hhX Krnapliewiaiewsorjuna'serturbediurgeimoD.ׄׄׄׄׄ>It `di`gueetwe*perogohicXtituteehagavadita.8yet@e[156]O0favouritmHuaMossPuTantraca@iIat?:seeyXjɔ␂exp ax᥻renon-icgeniuoculcpbpassXHsldfȎourp coa|warriP«thhuma ti*pea(ikn#hnoble(solutiSHego;gdom ʦacqu`@ed5loH9wȥpongruouiplofXucihȡune,Hsoccruel񵉬on!h25cerXIsschrift `ool. wXdefinQah}Ү8XEcticismgre`3BrahylX hilosophySankyeogVedawӗp0-f )xaHQwiel2pox7shapT8igiBxIn0 h䃪P`r3fʣZaqߺ">Bu8ȟi aissmutupyXtnicys9e dj*hsAfPdep`anyl,YBDivxe.Ϻ뿩rhau@mpromig`mI)sm"떍spi0typ[iadopmr d@nb,X0ymzfuPsway;)\BrhRy2apr (phen8nal@fal:lluGGGGGG">AgؤmȬredempٞdvo n@izelf-effسIrasce???@дɾ(embod¹udu HY3a(hztunbsorׯׯ">E#Gm 9diffP/͒`vail;y3X"ʻ0nos׭fspr؈eϵH[nXs.8OOOwwwrLu8r, [ȠBhagavadiIinIlaudabambi2`harzsconflieac؁c peiaii1wholwouli@llfy-spd70fa` ac)h=rbeH*languagJuccIiwdmirRӁ ptan`byarlpeopofndia.ndhis theoreemarkableinceworshipfrishnadisttlyartIVa"viteulHinduism,ჸasuchoesotppealoRSais,ri rs)Siva.

Butauthor,aturalYine(y,aileHoroduaongruou0chemesngr"rei).ԋ(resat8ee@nmostveryxg@tradictoteach Є flЃme0dsalvationyifxurs(Xbyxanstinem(wiwhomsency(@ereeoi ytwutu:߆߆can!t cefusideрA">HefpPmonYlock1h(ogethrexay:liberjjriasceticknowhgeonЄR9xps,apalsoPppl0nt@`[159]S%Ador2Onekv0٧"9chapН#six"s Qfirxtolbenefit"Yoga;Pad ashw"fDspeediattainbefҭ׭׭׭׭׭>ISse(den(5eded.Q(himselPaqunrxpila@2Loooooo`r0efRmaؼDSankya]cep2(hi`large`(hoXbookT*prakieگ"8ʁtma r r8Brhm;pHHX iNfundaWosyms.sX `seȐ{x1*щҽhi-ic''''''">APtud0(#y0premark:ѼPimZxeq{excel60cHdefectasuq& C.Ǣr@aIZmayaiЏ9erضxڕSлOL@:reŵJ@li`alwwwwww">1.ñdPKɔ՜[rhgoZemphaImּH`uЦ edoٚb"IPJ`o<@eight="1em">

"hinglhPeayself;lkwovenphlikeumbpearlsazad.Ɉtastwr,τh uoonHailepos=0234125 >[2]rlatwhichhfoll`XtiMr0elang,YacrBookE(,"ti薩pxactmo"telosx8s./G???ȄRanysimilar8presseaeevidYefHgraf@i`cncep Sankya#qVedanta,Qemp(p@yiexPe0[phenomenalÊ'">Krishnaavorjun Jat'yqueH8vi trueparX‚2finihyOan,h8jlgarbincarnZ.t@om "Xif%heꩰHous(sHr8h*Ix." á >[16!|wI}!azZiHSclaim"Ood!swi1our dod (alsBrouxvaripH8rhm(hd!qlotpsagAcelnakes [countXorqs`ațaastomachXmoutAyey(s`@,̅\U^Oɘ doʅymiddIbeginnภ9belihbXb`)*uoir> wunЈ# ha rWxa#alfiС%uL2#radiaiƈP`0betwe sauypervad@by:alonLJnderfu{rѱpO-soule!ۿ` orldaffedz`pXo)O`pcip(wao!qrapidpUfȆhof(reaszjaw󬀌#PiaxsmashjPstuck]jeeth(ʅJurrba`wto0+ЍS oYroѾYૠhhڣnXAsߨߨ3ߨޫ0fا Xveity,GBȊKcAztopeopІ oojon.w owŃlicڿx Kga>k!"oooooo>Hwe0rianembisusubli5ridicul!ԾAIJesg8ny2YgucHs针٫1T1disp3KrishdIitp8tygXm'E,жɮоiHindкipictu ɐ:ongruBabsu0gOᙠh8maAᷨmortal*p _)ihaagrafaioەSfurnp !ed(cripgme.>IS,^claiPуkؾbsolupDe6supreجXa`SѤEas1Wxffay(teac2@cX;Na" ."ChtGodnly(ceecamencarnate;ndxhatɀionverylievingoulasoutseedulssfied.΁,allesewoousyyears,idurordhrist[164] Teian,esus@$elXfod's h if, HeoeÇzۂ alvr''''''">ButHinduismّGisueda8ntinuhassDeity.ԌabsoluSpiritrmuselfithb"sacrsport"1rcgeX„.yria`"desc`recؘ"eirPRbook(1degreqXmZgrotesquenesQnotfewIunblushvil2.Ɋ`) teqfacɓsKhnahoo billR`xccep Su0`xlx(popular-dayPur whichJknow4legenX1Diwiel4inflHo9ml⤪diffؠbe؊8"topE@onfeti8mtyzvpt publQknarrhvEng1씸uagIwernnsidcrpunHabl8qimpPonm.ththHo(؎5=India܎pppXskHQ؜0eo`,@1 pzg¢ˆ pur,retu([X8Xmemb:xغ)(ic;pz.^regarQ !$y̼!|wor(visؾ`aGita,arks:ǶǶǶFXuled#ual=Ți@ifroCh n(pןןןןן">F˼xxsX(ҺB,H93Khhavee@,pfi6peindonhaCӄ.cp¥SurQ軑matacQ`ic Kaxб Еnowsa,KprhnhspiritЩ"*Iyaka/(Ζfo PuranQo0rhucwy(0:(hysoceb邨ْ:yefxH yW3zsQ"@@vԏMb`kfeɏRI/hhbeauIyamoțhm8ftsgu@[thus跠stwaY0_Ѯ0l'ɔnlulud?-0pHNss OHhwexsai񑻯;Aɯl0+s 16,100@!y180,0sis butuggestionfheorrectnessis mate.ven:incarnaBuddha,hich,oubtl, highHndJmongosjorpordtoRHinduanon,[167] WhxoneginRcompare[ictu`Chri`anɋithatanyYllccupy,fiXmvolum`lite(afromoon-dayEgypdark ">2.Ԕdoctri tma, huelfsoulmo0incdance]eankyasVeticchool˓dualQreen@,s(um:zdnctAdwa@hilosophy, :)se ityimmutableenaLXaoˑhna'XrgArjuneorgQm#bat sh bloo friends: "Le瀰ve lCn,dead.΁0rdɊrexrouKruler;:wu Yhereafeaў.0Xbodinf[Pldڨyemi so࡙Pacquisa;nsi(y(ab.Ai)+eyȒ>unl;InH݁-`zappertainon8n$ᩢuctIkfinHsaXa gɞp,Ϭyc ha!ȟ8h inkbk@HH77bXnow)Pg.tBbornB$,a3>.nSlag,cgeXprimevb+X\9lBfQs+CconntІ0lhO"myrIrms!ou ithus.ƻoۜ𶠄9x+^#birGX."wwwwww>6a1ȲDliHR;ґy:L~i@ő2Axz usory¸ӎXd*Ya8recognġhRᐈin`si A.nj' poHb`yHQSanky:ۯ waseeqەtteacLD)eay ӍowiqЩt98fessҞniyspect9 doctr2f ÕWicش"emppspiritu0racЕ sorigYqinO3@LibeX@rRedfouBgavaditatr1(mbI ayBrahisminculcZthrɴsK"PRaddA"Ã(foll8yth,"cld˹ynanpursuaKiouȌicw0,wssuIU0ccept`1on؄-ol rs">(1)›`leadsxGo aЍ(Gnana)Sacrifڴvax0dowhKm˨IxoducfroВH 2ZjМfetq;worlseupρWw@ЖrwhyҤɐ`mdednnowledge.venfoureheostinfulfllumen,Zwicrossver"trespassesyXanfboatY您one.siwe8kind,rjuna!educfueoshes,oZڂςȁactio0.orHisith@worldosanfica [170] FmmemorialndisaghalookpupGodSuprtpige;ѝhabsoluteisdomoim it"it" (Thtwasi)3w*Brahmananait i encnthebexa醘rp9h:3lsuOѦsy@1oup,cogn0Q8F"Avi;iol)Hstup0tqAingVoAep񬀐 HӁ,ndhhacoCh0usIMayd??=1??`leyn`f AѷJKarm%ft;d(lupirӺROexiJsnAah{sH`ءthijtuȔc(arop wȤitsc)7en`pea越ySayutch goddt`unsci 0m=hnevArd0urbed.>Th`מa:salv aJHpHclY(2)IȝlibeInculо`j#-:asceismwwJ+beจZ1Qiety.,mback{leasu5b, n*h(laxxnȹaphysenjoyº+YpimrigidSȾ.yxHy 2ayv[bodyn;ssfTcsoc8nish;ea,XreanfӶgCMxupdep 3cwP|ʧ d pcsads+ 'Yoga;6pi-df#admiH1)>life߫߫߫߫߫">I#DLalssФXxalȠ?"!devoteho:pp`I,*punmovex dsenrBoُлН1gosaXHхbd.shdxntobB,PmX)inecretlace,lon8withisind selfestrainedoutxpectationsRbe`gings.ixHseatirmlyncleannotooghhrjlowЄHcovered 9#heof@otheerskinkusarassAth*Anx,.exclusivePPointHor@gyoensewphsxldractidevo9ppuritXfj.husnstantRmtobc[173] T(hSonamouahasndiae0YePferougentpxYogaJuc0cienҤHelabor"2degr"ridiolmost c.isteіؚ`Krishna'YXuw!peak "holdya8neckvQunm8x`palooItipɬAownse,"t?ppz\itudcansWwesaidBarbc9XloԚmHapOOOOOIeltiimyGyeZ`vfromBslX˫XɠcessB;j4i ''%4'&wuikmn;2[ure biȻPrdPyHor٪deg'''''spiм!Huɵevid`QitxaltOOfe.tmadL8؂r9QemambiAal`@rId൰򴌪ffac(~ؽq XbificDrwa8iҿ`hcc@zlX>Chtian, Q+hH,m`z2^Zԏ[w|Cr8iJPialʾ8e஺rigidlyjed;"*1loweanepiQh dBhömdmpleuؽ0ߊalsoqIaiXvalue_HqK茩 perfectrowdlopը"0sx(ul ‘.">(3)AsXnmpizѝ ٫~salvIBhagavGituniqumobs߭߭5߭߼ȃ8i `eacsu`irenu0+wwwwww>Sri˝0hnays: "Rsrbpujhappss.¿؜dtw/+￷3Qngp5)mteriepG8ta@viX auX1iܱKomQgicZown,xryˑ. "HPhoҩ`trollQsenzwibeڬtKormXons." "Heho,astingffllttachment,erformsctions,edicathemorhm,sotaintedyin,sIotuseafONwaterIndeed,ereld0atome "tm ؅rinpurity8elfThXseenculȄqpexiarlyn-HinduoctrinorkKGodreasonbsolvfropPfruit9h;ea,ore,ɀverysPh3ndppro`ecumm8rp.ti؃ ymotiveKrishninPDivYSongҎ80rprwikuragArjunaHdmȐP[176] But̉ordemayeffemaccXrescribrulnichacr!oobothusefulvЁemAmIsW,ewBxancifice.͋@"haР8(estroýoThoYe@Qnar-@gŃ2p!@nalkxĜ˃m]nנVvarioorYlaidhwnmVedaKnow1ducő5k@ّXres_Xetȇ􆍕Idolatrls) XdutyhDesizucZ͚shiKثxxWَthӃHsob)ePagg٩mBY8){meEvI ,ϨaZ8ibedevote8fwifa0nl`b@irregul.ƵInjPiṣXx. y"Ѭ776776-f," i.e.kretur3֎dteH9c(poly1sma i,3ye@뭹wtegaldegene>(defultitu𡩸sӖy3enas sy0鬻12haٰ4rngȽimsS`aurUyXur-fsºK*b?app(ػHrquڴ0ElsewHind (Iȹabundantlyگ ^ۅхjaҰAh@,Rshouq loجfeet, spX Thu{mosxtuposystemsoci@`iوtbworhakn)Hinduh`peolitalȉPacrHElif`orn plershipہto men;bwo ean+mh3Yso-callx"[179]BusrajoB*6wwɩhe8bookira`,[seginn,denouncPIholU.žț@Qcinesǂrebei*exeǜǜǜǜljweaخlН8a"a"鲩whenremarkK xأjpccdKrishna,fre)h`ach.Ί`amo0quhenpcU@hPvadita3b8deIv;r$ᏺlTcomR:Song.ɓ 8xreovirtuXjegar1u@-whteћg">"Yobuؕt0(ymeaXz".et)ymo "WretchhP@o4|-TѺȼ((,mѼ&ȍ.Ʃ fDh``2Sum@"8sakl80alwayr,)npnpo:zengX(Devoidexص,tr2ٽ(Xselfdۏx؂qr>WXx`(X,ǸChptivalu8iarⰊ̋demn H!i3Xf`(( cdesinob0~WVexal¼PXPvil;moQa0barhPilibriuxes𷸿s)hm X_t 0Б⥵!.oQ Hò@Xȯr,sA bhABHWջHseek8|pultxssֹabH*:un~o aЮ>(8ncip$ʞsئploOH|olf tellucalmӞBYnimxg0:clearp˽JSayua:orp )Jrhed">IȐ֞key Hrgge1gg@ٳ`bid`Raf!gooؤX蘇*hnUrePioпvitX cane 0adequateotiveoeligiousifefoodorks?

Heresntroduced(othereydqthEclecticismd Bhakti.______>Tdoctrininds supremelacneivqSong.gaeansev@onroKrishnaimself.erhapsChti"Faith"stxsseSfull2ing+.~says,substance,anttachmentHultsayourcts;utBz`wh(m5God,xd(I(c4noblmpulstha8v">"AmȓlCeeхbe"xf1shiHmwinmoY9!edyQp8񁢃d." "Evenfhveryll-con{upanye8mertainlydC,擨HhaseholvP:mbeco(my,a]er;`e2thmakAzhXgoalKSXyjٔPrؙ,ADŽj*!O օ`crifiH,Wer[182]Izprobay"gavadita8ir`盄ȅA,cpossionpasonaladoubtlaroughew(-olatryԚ XoedanthohɴQIm5neffrOne;NalsSankychoo wne!nownrhedP̰1pyItePaeifeatu@/9incarna1zVug">ButY"IeAdortBbe9n8p᫘HHuigzfigȉow 0Tpower@pt@rAwb0gscwarm؞YitiQRpt.ironiW iamq ii Zbx(cl(pisXQǛźlik׉&side`ors`cѼ؇ pri ;٤""-خOOM3ON%'IOo-da((m8xٛIc)ȬXo?8.or"@matt*aygppritu0kQⷺsȤ񙞗*rembus shoulHeXmembpѳPMiIerhapk:0mfluVa vfwpi׶׶׶׶׶>(4)it8ai=vi xc;ve|xicipljXlomA ?9hardref (adرٿwhichominI m@(ark[ha"reg(nkeepвop@duties,"8hHgɽ. "WPrgrуmdo; ...9sP𽨡vitg (s,updevm ppY1X" "H X f pfyPa8tahedoughHsTsag]҃ ;:b{rahmiclisGGGCht="1em"lign="justify">Thisertainly hneithererylear,ortldequate,s Hnculcationfmostundamental[184]<ei`> Straspeiarɳ/)8nɛ)i b*enuouif*Xwou0ha( (ex(k/طsk`v @D8sack7ٷhneyPsHa2ul, i@0 kbodgrohpa`9nakedۘB>AHlutȼYofa),r@i,tit82*yowerglo diMzꈷayoneH9seгaexXA(al t-֐rue𒉾son??????>AZ@U$PM'rngxattXthrItsycho, ZinP0ѓG,pk9БBrahPj$anyps (Ysay 8,400,000)xforecer3fbb|s: "Pa`6 fclu@1newɚলm*dg0goY_]`"I㜚zbirth Orjun)you8," ;aɹCOhrrSr愰!xiaRedbpa0`peymhj.betweenӻfollowӾ°ubtlodyyXJe)Hord)fruഊI)remHslefnsstreoP!yZ{椧up(Xgu}setȼ8accoun>q1sr ent.þϽA3¸me"X+roC̍GodynjoetialWpleased輁zґ]pmortCwhrPexha`ed0Af(erhapmill*ofheseumanncarnations (and,dee@8onayefowernimal8dvegetable)selfill[187] IIITؔnHb "Divineay"sre0Жcbookostxerishȕ通h8extolletwoxndrrtɇڇdždždžWxre,ir Xmؖpynt isichisfiguc.ard8a@g2frfrom!fldoctrЈyohAifeh" 9wiZffort8mon(kutCoreacargolJuou0ZpIiڛ@" H">O*wqSo@hoH:atZbgteneJaPtolA qn 8helpeathi0view!GoQ)Qq#eysalv#zenunciXssf ,eXPXthrAҔsem4beautihcep;instru+ beyoxcaviY9to-dmaHlourl8-menooo">BuploȞHrefue!,0aHisПunԮWWWwwwplacswanp8rdqPhon𼘵QiaGospQhChtianity. oso8`quisiٰ4BgfXAxstsahop0߆׆ em򩹬satimS a1ؖerfect8hPаJAsle-medxaawilynumboohurgupuyCaappeˑ#P.ԣdolearPA%;ēwalk;QѕSԐSpir+pоovep(,Y0hls{gre(nner,She9mc˻livĩHim Аaeѽ>Abo8Bhazrehinn+recdosacw_eXndshock⍲ir鑀rht gcoar1Xarrogў:imselkxutf smak \dehdI{suDeJiZzpaŏ*hacul؍hrwgHcla(bodheaysXܮPpsongruḸqxAll h|untolIlۓtiitPbxe0g8ns, "8aо8imFer."SZ 9betw x(J __X̽*ȂſJv(`pfqonᄋ2
[190] CHAPTERIIPOPULARINDUISMLp' justify">InheasthapxeweltponhatayealledHȁ`Hinduismt9systemfoundepiousxerciseichngagesatthion,YractÂLPinvitdevosIinkinghsąold.ԇXBhagavadita@nly(emanyritHs4ser(presohtful,som2hconcepsbdeepe`yearn*soul.flfaith6"Farō0"a lsuPRHprofoureties,rinlofty擐hspiualYasojBrahs.nocatudydugp(mo@ sve׈IndiaouttaiY႓growdmram.>BiYremembareЎ@HeHure;rPyؒ0currc녋enlGxfNpeople.<ˤ91Kamlns:xhtml="http://www.w3.org/1999/">Aravinhrine,Ӎ8h>,rregardl ^yr!⸫dormhdernGGGGGGxtru9`,goS>earl¿VeKhalnifbi@Â :uniscognX张i0ٴprimh timVarunreHtheainassionsndoralbliquitiesfeecentods.ndeed,neollowscoursetimensequmultiplicat decpia,seir8nateadyteri=charac,ntile[195],hilaposrutrce.yettho0twohavxttځpresimaximumɉityroughouClh.

Tsafш(ifepnecwithstomeoplInarlyedicPdnintus1chowisfigu0th re`exi`dmongdolatrykcaymy!degradw@`ȒIaProwth.evؓ؜torx۝ndiyK flـdo__uhtbR9at4BrahH2i(primhstagme0yethnfaI!pgqechospiXuynidsouldloptsaxopowxnorpoadehorizon.traY!eaky8af!:super)1 reachrr𯹀ivW777777>Iwi-gXuh0x8!6bs;tsh'yliveaЙmx''''''>=oȃoissɺtru dexElHluafwtpYhem㾉h)Hism³OOOJh2킉erTyy`imp: "C``𑜻8Ȼ.̲Hs`,Rar( ҙn,a@feeJwKiA`too"Hخхɝancr(AelfsKJ7QyemIefficacyIxint known")xpympatXwOinpityߝpdesiYoibmlʸsalvChrJesuTrXTmo8Gr|pec$Y(yhliJayChiaɡldlyrosaicIactl. Xpoe,ﻑ-piua9dedyaee n@@ngB"also,OL%gernularga cidah᭢Qa`par!dItٶ@mؽ( <,CؾӉ(Ʉn:y9yȖ(@harڄ5  zwhichsubsidHd)ʁ)Ȭucyly߻߻">Moreover,heeoplefndiaoughtutndlaboratedostrofousystemsт@osophicinfa8remotPast.henrcestorseredepthsavagery,ngendulgingAmetaphysicalisquisitionЄhevto-dayadmi0wPer.manymoxsncientȄAishiaself- pellfliitowardoddivines,:pir[198]<e="1em/> TSwamillqZWscywee0,persuasivengl,p;.™ApractiБI)uPitr9idolatrhabit{ bondYcXodPisoul0re؍uls|fe@ag06WCye꘱Yuess0iparffaIaُ )hd(oqu1">ɓ@s (b orgottɓ9me+کI0rossocea`p_Y,؎apC.mcomd:777IIIendeavanalyzspџ9PstXyfxu,Qah1itni𝈵l">1iBobtr8!siiphapde B@ts9 .qxmxcɷxtinq)d :onCᤍq,8buॐyH)penetAXhmKxh@fifeen8csstricW@altiOhwiY% contib2sIp#`ly0''''''iȂkQg_A,(denxHe`berѼsrhm (SuQ),nPlЪCG^% d,g0(2agʩYR0worinown.ŔXn yuragogowePSoumbrexrrmI!jarmde bemuplyHwy-fiτȬ himaginл۳QBrah0dHdh㼹(leIgra!l@xsRɴRuddhaxcѻgRhoon;tablishnewعfsȏ$ex0غanyĦBIf-sHarliday6 qwhunho200 huyfolwce Xyw dd阳achgy I-ZKE,fayhamJprote`@dem3qxrpr!iHabjPsؿğߔ`?Ѽïgom@asshӴZgVǯǯǯǯǯ">3.oreo֤v@arPedt"@)aȦڼdory.Կno0nxѠramYii(3ȨQ(R2.fheodsreumberless,owuchoЁ9idolshirepresent m,ndԂAfouinveryamlet"houseruponoadsides!

Inddititoo(madrgularpermanAworship,XyriadWToflayҁaishableubstanceHbe dtimnlyˌ 8thrown؆:ei 2wash@awbyain.>AatPbjectsFxIndiaA!Ԑymageʒ&diGreekbeauhulcon0eesomelmostclinpto[201]BujAso 腌͛at}.xl`rav!ugh؂HgrelIHveprdlyeM,,0mae0ٚXrtiȀэĐ.ϛ h,naJpeculiar@grosr8ltingappeaj.runysʜp8#Gsh.Ȋhˣωo,ttemp shry,𤏝plaX4peossem`. bnSiva,8Ԉeڜ QH"pot-belliK"psPodyyЕBelep`ead">OoursHinduastAnijudgsw0ern ds1^failKcogn8faciyyphu؜MQ. anՁbl𴒷ir[௹ulft[ix˹@bstrongp|Jputw`asl@ca)iجruqpfȭЅm8romJcth%va .ϫϫ2ϫνbevH0nsif4jiaИToireti",Pr0!grsimmehxvicinity">EducpdSxthe0oY,yy 0—cfamipgr:offeXoͭH\ame߷߷߷߷߷">S Xчa8doZŸself;ⰘwhoYsupposؾb齲pE1JdmiȼadidPnowD3lGFzinө@xgPk)s*[phonBinquYommúX;|nreCɊ9mH,HyoWf%Yyeap˗i\mage;~{g2iaxbasnadraQdզelEobject!pࡀhmves31mlns:xhtml="http://www.w3.org/1999/">TwodI ,Ӵ hӮT>ChriPCollegeagaz:>"Iaurempicj,a5beoriatXxbsoicean. lԠȶmapicpnseogymbolYndhemagenpakewholehowuite(rally.Hcanythingeoreegradtoxntelligentumbe?enthat e8ions@necessarilyor쀐thropopphic.uturopularinduismurpassesverDelshnisspect,`o.heaamousrinPidencyadeity's chotaazrieareal]giwithreadjbut,ʌ0goponatioA ti@midnigh(nappriaXy!decoctfried gerhelp ds2bef `reti؁B0bedroomۉc(orts;щnoaωʉ3aigȋlefte godship!smoke;%,ndi蒸m!`aominalscXc,e9ӉpliɃXfeetYtempleexchequrulowt neyfeXgHrPvoteQpilgrimnumernqm)Ȗؕ`iY wpppublicav9commihhH܉h-wayobbaciLdetailuaannual[206] <"ign="">4!kfu monWXi-worᴁsPculi[aniShndiaMadrxO)ofifȚ`l[0m80Drhn-thpeoxlʗx)ʊaᨘ`DeoPry.wwwwww>WQBrah camo'iac(go,Hth0,lunis8P҆iHmКi wyalppaH$: "W@7وdroyon;awҀdZQʶ@oq{gȜ.ÄmJbaȢAn. #oreںaconhpx%dуps`"M"wimsbccepisXӁabsorbed8'n c.rtih warRbe9ԯ f8fفloymem0P˦>But `psuppatypqu7errXݞHa8par`iVۓ@yX iv0p .ϺثXiЬʰdshapPccpilgrimag@2vixsE2Zcdeit. Ѷchief1c!¶daiuccup.5:a 0ĿZsab ɏR9tY`llll-knowreham@Ъ`!abd eꦘb8remacy 8l-afrs;st do_8otisf"looddsGGGGGG">ThȲl??:ar(fث ers,ndecondly,utongayehind(reȀPus.ye9greatanyeoplenheestHinkfseaspuworshippersDigpypeBrah(icalaith!

ithouldot0orgotteallverndia)probablyiftyillionwhozAso-ledutcastFl,bmiserduct]y0m9ism.hey"*ubmerg(th"O2onsociystracize;unddefiniban 'ew$wooddraatPHM&havlac%A;ߍAHmi(Po `iЉ8߂r receixwecomre0Pynfɂs privilegehiy`niB 1tyran>h beXsuch,urixbYc00pȝ@oeepslasǏ!absoluzrvitude lsoYusxpence;tauچ (becau0ȅpeʇ)(satisfaw0pirit[209]IofYfelˀtalk離oor,ariah2I scap `stirh(ngȐaBloosattacha+ԔJJlemxarLYHssC doubttexinbyTsupЯ(bjectrels,ژ2gro؅%xOMbagepsequЊtPkf6xmyregarvsFelfkgbcur@2@oªZpmZ-dfaggggg">5pen0SlopHp opularh fڜHAXItumFetX tribXӺq4sdpsufficixPh`,y(ceptл oko imgodP.iqAfricahڃ!nHro8aock aonH'pos@hso8zit.ӠAlfLyh-knowutho8L,old x0ǬǬ10ǬƎ𧰽 ½Ⱦ(RaHmLgradelopi,fromx!ni(ػ"۱Y trP9IsЩ*ancHShݾiinŸpvxІY+, Baeasyxbepėg𙚺Bȕr⸈E𾸳2FhXvh!yic,Iݻde8 ٥oteçOOOOOO">6.o`ng alsuil٫rboXferim`ty">TiruelZrny۪ث*peldY'cXac ?zSi rѽwX&ifuXb9霂mpuug0ppublis2Ph CTEngKHuwouHDiab)o`on.hyear8go,oDalhxipVproʦenwxnpчlehЯ$2hexercibyJ@Zmp9em2 *c98.1wr?bookgP-d(˻classicalnheeautyfqiranguage,uthichBUniversitiesqIndiaeclineosesext-bookscagrosbscenity.

AmongmostPmor ziin(tutionoJyouthartemplears,|found!eyill9anyequenc)roughd.heyerectedte0expeyhor,†elabtelarved脠ɋ`drhveyaa3odHÏ*streetsponePvPoccasYˆisardoێ#SZDtInoisfigur`XsuXsu(orblushasham ɓendHlf-respcommuo`publicazIchildr%play edowai*葈g nmwoulbid HbY-riyd•xdgm(vyinterfwi`re2eox!כככככ>IVaishnavaultHinduismɒ;leaIsX ellnowߙܜ!oPworpYloadimpuPy[_Xpterta)iallyie҄pmsexprach canb ed.[212]hnel`mk r8!ie0!d𲀩zqsunque acmh.fro؂radrq"odepPrAuza跺.ɼchildhoodȘbogfa,䁓ymh`i0icib2$husblwidowrbwars">Lв0Kisabilit3l-daygggggg">Sheqgnor.nsix womenutfnehousandrebloeawrite.heasevereregardesorthyeducation.[214] 剨knowSacrbooks9ownaith.tsሰn 5-dayoryaoeachpȀHmos#truth* Qm9notXfitceptacsu">Whisothing)dochooPgŽselfhusb,ʈxboufthrougholyedlockocdikÂ܊y xQttainsلwhhbecȌwidow.ူaus*ar(supposovхflueюhdeathtthwruelty PW@Hevilzh''''''">Ows com1smarriageeYxtwenty-sixll3slZw`uXe fiftye@simpthatl `po30Hghshipcempt;xlsoLpr0lPful ɨIfallȨ8grossXsniigonA(htbuH1ۆ;Sresp vx/mitsdians0XЙۨ1whelplegisla51;deterkeep(servi hazAǫǫǫǫǫ">8.Ԉi Hcetic/cac(icu`97RٴOql"Xfrmmemoxl#Yлgn0thpursuἢp@cbeg@'pږQpla@hJ,kpilgrimPyzInp8sepȚ覰mhiPdevo1s`ʵ wes܍ulXxpi2dmiHLb؋munityځYyasآP(9n d*ellrob,profފapit0M)(peopl?_____XԬDյ Gdicanon- duc lIupAtHwDdoubtlpQiasee"aprGod.§Lvahmaj(IlazrotʔcؠJir3know uhrhwoQӿோIorx(rIۂwryeK#ccepmhtyHN/nEɿOOM6ONaо0wouayorPѪj,dee m-r#d`refuof@YV+xa1dh@nvopd0rAs oPdeclhQ*Hm꼑PodoxȒ`Չxb'%׵׵׵׵׵ם9u؆hugh28tramauaHot2lap%z_ʃniremSqshow`bيJo''''' IᆡHinasucharm`aXturdZ;,o`X,wavLm0ˁ;׸Х80yboIphysHJ䴦!>IRequJdisB0pϮ/{rnheiraithhatoargeodyfecognizedypocriteshould,evertheless,ehighlysteemasypppiety.

Thexincethislaswoyenveal؀(o0nohrtrikingcthichharper`he[217]9.odernn inculcayspiʙimamoipeopleeuranQe ue,IPs!ityareowivKugairageY̑ ngs2evilˁr1exnpak`unk8oAҏ8qbagainўgoo郱tv(no ogH0 Q d›8o,J.Tx خ=me0(o0rdevot1emselvso hthfuirisAnHXër8!moHw hZsymiri Bng+lj2g`2g
[220]

CHAPTERIII

HINDUELIGIOUSDEALSSHEYFFECT
ROGRESSFHRISTIANITY>Tohetud fomparativeeion!reppearanyrikingnsonancesetweeninduismndhrianity.́aeepoten=us`oulifePsm0expressseworeataiths.etirisamuchoQarkedfundamal.7>Inhit@antipodaladealshiPyalt,Pspecly,@f13followers;znflicQmostubborn,tpervas,tAhtoXcIndia.Ԓvi’Go˒`P,huattain,\we ٔ䈠orxdox{,omBi sld,mply@cau؁fAn9.ɓitagonPnpitxpossXviolat`2csh4hׇspiuendow7h,romimmmePial,XbPdQm.1OhzequI(how0diffؓdܞ=sFproducbgbmake-upropicEas8e;naern׆climcnlxiosyncr%pȟêlexť wٛ ooo">ButHe٩dCrh,ɚ(ch8cc,yaquer oypurheenYqre`b28yw،qcepвOt &8r[كaР\chdavoijeol:Pfovxw-*alwayta (be(2agcra''?eas@~x ordi lpdebpRfluid1rXaccursslX8ceyhmSgrxorȫ cPoJwarfPdegra@g߃Vpmody׿׿׿׿׿כSbeзab #v2HnuJu`om(ɖpulеؽ2@oHixwHguppʥŰssummumox9ݾ!u ea)w$Hn( wi؛벪xcDžJg#,oHworkb@aлyH錡triumppчI777777>HgreatIalmos0B!anscendimpąchooy8thrڑsowseqewhilosophHylsorvкJva(erviؘȏ@erat pEng B+nacularb!ڶh{Au;India.ƷQf Ŷ,Ki8*n8[ogaoualOnfamPศttСнGo۫;jصnrmtctiㅹ^tdx9ླྀr8aʂ(Йvi)">Le؃srfHHywhܺ3obtrudmselvupƫ''a>[223] ITheivinedeal???ooo>InconceptionfGodheadhichbtainsnhriPanityndatbrahmanana ( +);3itWxov(rou( aڒQreDIndia ȗPwaylac`Mieҁhcornert(,)lb2$rivp+1beenIetԗ proc(لu@gymnicsoarkedlyharacȒs*h0rm"thHrefxtțˍ!h0,\etr vour2outgoing›ٝDcϛ.ƒ hsoalsZHtootbit(aޜ,ro*irssouћȑora(avi )J<i="-1aQ4WVbl'yHm9(!self֡70axseȥxiti`+`barrix'X`l؇hipabsor  d`nemyin+mHxqu9beauSp.A0wّ٫salv3ex`؟!@summumonumA𦩪evybyX(-knowledgpjz+p צ{I@dafr1tudr0裩esx~amȸ/7do؃cy#LorL"ryhlif8!,Ⱥقֱk5Ap@"XQ xXs`amn."u|giٶciJLevil̟ocrgP hihobIhegst*l똈tsYdosTimag muptorloosɥswo3 ܐmissarl8.5

AalbcomYnxaequ:fEIѿms( Kmde_st p@pdrPccou(eepePPergVophilosophyology.___h2cPer">II`fundamdoctrQ| !Jesus0 @lsoȘshadow´XmoPnsism.ƨXϘ7dJqblQyw`e3aiqPour.ل@y efȿ8gexfrпɞƁ|Һobt 繀o(ib8aYpH@typeAd¦єpҿ۽ԱxexcЭQlXlaw xhQpchaȴ@vXʱp٦ԺhCath-blPלq ?Iinƈch;cerianhppl6j"s"GVishnupothre`X(feortoise,ndheoar),oralestsrofourYoutyplace;ory0yepplicablogrosslyensuKrishna,hoson"full"ncarnationodKupremepopulardernHinduanHon.saveeverreamsquaring"goX"DironsiththlemXstards.

Whatso0good։u,(descentsaiPocom achi)worlXitertaiwas`t䎹pirity.ӂXneˑ[excellencaraton)kpurpo*Ch8toe@tirsaHxwaym(s"m @!rgumH!ivinharactarpؒorigin1th@obliquitPown "s lcontraryώώώώώ">MPo,cep/n gAPemșJew@.t푈riumpА.llns,achtro@aPRoHffhimseloYpX`.,ayo-dayhrPtw0ynturiagH*Greektu0-blocapolprut[227]ptwol(Hlor[?:spot0s*aCadoچ0+habip l1c@ȦpIIIFroSabsiH$ iuojlud{l byBEa)Wf PTfBCʇnjLSdomtև "FY."h`exalceticAhPtypRbmethQoitq. ;лmrхߍd(npw [N-renunci8KˆXhi,fouunisadmimopeopleq@mot۪poЉrYMnncr߻8z". spiؾIlZgo(wM̠Rr//////`nƑrigPRI,deed, IPEchaIAr{pi uchi(!ҿgp.earQ`aA@ititorȵsyogisrecɡegt8yȔA`kurpoaccumul•ȼa1Hoн8mArough̙*cquir(Thѓx0saioaveo[229] ButeasceticxsotPobjectself-renunciation,Zaeritiereh刀{mves.e o9ll simpmengfife, alsono8smbhonohe(nPtim(sbeceyetpXichXQworldb ecPood ,r0Hou,"gold`,"is, samregard.vilprolo9Ahumxi ;cond|mIbes`possi ">TChrPiaٖؕornsupsH!paAo1despayvail;wtruggqugainlX`]-/AR@t;{lll:PmIilibriumidoorwin1yutchiaZ(absorp1).ԝcharar"\valo$rbouratuboPY`X nevbeeaPism.#sonawithf@E ,melyine-thjfiBplfill@sad(SfakhirRIaun rsZrecogn JpiHlDirwwt30wwmorh[dQnguishexa`wlaityMl1slvoi8ex@omج pekqCidealperf؄ KexspiвѴ;9(,Halhˈvorcfrom@#yr8mangruexnd`$ri g(u`lsۆexcelKRohzknow軈PrBhfo8yHmXdDlogu77777 )cavat;mme㴋©٪88eld m ifluY{oMrgeoaupri")potpowоng#m(cseclu!p$M*iPf.$҆Yaerٿicto`sҽarhipBkXledutiIhpЕ $muttwilH,GsciIanhabitaesulXb9typ¾??????Nowview*@sg@eac1doa?Ӂj1llsemwisdɸЏPn/.1 ?oubׯׯ1ׯ׃`iX`0 ѡ)wcmouhЅ8Pasprequi8)"lsopЩ3.ȼY,ɼnk,stXnIndHyZpa@6Dmat md our#)lf-H dzPolagg1be(óevotenk.φjäYYɲlike3[!-©oEpXp(rhusyearyrulsС9haoXtʸ`gnڵ chi 9XgQults">AyWfurnis>Z8t#c0pQ.y do8܎ ث0Ysag3yHraleQPhc 9Ah @JQeԾreaɷē)fWYhowpؗ t(cerned.tsnoughfeememberhat(absencefnncarnatedealXligionasedoexaltatтrulendePoniyssafeguardsPyea,ore,veryseaorthyznobleife.hnoddhfacXnndiat[232] A 8鴨Xo1lus霈齨liQsenomXaquietp9btolp()v(RJg؟ٯB!agX0I ѡ 80nxlaX-twoscCChtian!spѮpbegoȔc@tXcls;ʃ܄2@X👏ឰܯ٢;ropeac⽈ourRipbpXyalorPČGnon-H;.Inxno0li`dxfew;rWWU4WW`ortaf *s0ifXEAapXciars@ ac(pBeevil.hpxffulH!viJ"ob(dXpupf)foYikeNe6okaq(xAɆblA(p0obriux"ih*."Ygwimoaꑘ3 8rcircum|ycheekjnemy8नngros00`r0`isp8caxll-orbcac.ur~.̈flaselv posirHerGȒbeauPu์ə%t.ea,r,qB诺Au8ong`ImascuØv1;Zt:m𽩜PiQ veX뺜ҵЊە@pm tH8ccusҼPШHimid?نmf*op8濹impulsivendomineeringigourfheestsreferableo"mildness"eEast.[235] Whatishemphadissi@arityetween wernypealif[eH,oaQpChrianorkerromGagainang8assugpmXdornedXthnlyoseGraitsjexcellences1charachhichreorpnunpalatߍKveryaultlsoCHinduXsideۃmakPhimeel sup`or tim@)inacsiDinflu.or,etogott"regardsؐHweallfo! petulaxrrog\intolҗsamapprobati*isgqaxؘ2ir`@eqtoh sevh, @nhommmRDeogu@A`oec锉Rcb}5ʚnousІ!God?ߛߛh2}cer">IVE0-meѐ[redursubIwo`hse0und`n0Pf.nW,qpr//-6/.P@u .Ȑks,a9sroughwnOHco-laberQHim.>Xism,PtHbsoluteHn˴aJcau8ȰstPnd taskxs(upUhouldh2n`PȭbtefUdoctꑈsyciwPeЂbvl*birthsPrn$Aada"affici:e0opportuIgrec`uKBunrself, ofirPsȑKVti8AXxomplA@poЩog;l࡫gloriYl Xz`gediAH#any҆#`flP.raPerhirremdegrad稈qrFε iBaд1aظf`eyHHUhpϣɞex1scharacc)fa8oppJlowมEast}` be,piٕXAor*6exXalmoaHitum.͑tud+tcBtisfأ҇m 7O cia4  p0𬞚lxbۓ`clasphHoХT(r"xQRi!onaoyhfnatW8Xh†R, lan`@Dpntr؞1joyϿȯ)lim)9;akey戣ɿ۫wq2˵'irrI{.azc),s0p0eptplgڒ!j) suns`HeaF'affIAJH@fep. hluilt3Bounqwɺrpc(u0zeaHXѡjQ@sweкyl¹fiHfh"lovpeak= ٻpmsjԾuY@rayrogg"-life"fhehristianeligion.

ButhatspictureichinduismasrawnEfinXtylotsollowers?fterwearyugueAbirthsnd(k,ithinludes[238]HpgainbQeowppropre8iniew-supremeifficul;Ray[hp1swor茱exencɝhuh dizopecI@oiddauᥐacYanimpiuonum'яwAqYyŸcipXtinthr bɤ' thlՇna`lvhpbra免pnȈJqwbat[Qd"upqbetDia=stHbҏbV.//-9/.>JwhoescologiymIcordrPXs teacXfabfЗaGȍv+oi(er'nv@dory873ko e"poDBpuroxl;rahXzhimg`"valSourtͳHjowel8dobe9siPransmigr*-Y*(yyouthfuXhopeJbuoy7H̱Sa@HiIwڅ keep1mp______XIWltibil idBI+gyfanXw,ຨtwo𽐿oiypodauirlas(undaaruc(ǹǹǹǹǹ">FuerwireȫٳxIumȦ3'l lH,qpnbremphasi(uW.'thnicۣmwAr /peo{l)imbibfronvably40ʾ`Si~ityworh! Qc uexlaXȩ-y`f8HI"Ͼshsd (1عrXer3brx 7Ia,K,hoiJ,zw8hA|m.etne@essumep 1hnc,1̙ЇυθzxclusiHb)ٍin-q@;EX(hXbeHhorqؿ(igwi@r`zfy(dif*Hyp:IlggɿPert8Q(ohzrdpi"-XؖnypngXbePw)ieWWWWWSify">Theayasomehenissionariesusttudyithoreeriousness religfndia,atyunderstandtruenward"discover sourcpower.bllقbensanthigheidealat ship)satooseirwna؄ notorgeAnyapproachi`genuinympathyʁqeci,rhP[241]
s "Ontؓ#,|o!`garbΧSouVdo(ea`iimpH94Iʗ◟Ҟ CHAPTERXTHEOMEIFEFINDUSbh!JHaղ &dsit@:char Mtbciviliz">IhpaIhmpPnoscriϣs{ 8Ȓ^imiIppref0eri}qccbtn` `zÅpKaidifso1partrOc¾Lʿylb z拨( fu@scmtoucgX Gc@ak,jm{XsstuarytuteonHp,orship9dd‚Qard`an(onneXϲ7I@view8adocе鿰deipfamp.ϾsixtehNo,romir0,)3م'hāaPpacШ0ix0boei0l.775377OO@abÑholb؞ɿHidofڵ`mlcorona0-mea('(ealth. "Evepmorc!iRpc*(purohi"rAv譸ǻ遨po@twic YJ{0l, iryȬ`cse`dn1buGuruspiuide⾘ruXweet(a:ilk,ԭ
<0lign="rightblockquotepe]justify8ailepos=0343971 >[5]rom "Hindussheyre."

:OEvenheuildingfhouseatterhichpeoneccorto2rulesfaith.electionaite,rrientawngKnumband xOooms{prop8perialorstructure,allVeminedybVastuӀ0ri,0Barchctwho@irs ssotoHpscific uppreXi8:yavedShasksize="-1>[2440abookZin,h!@basXplargelyconsiderǎaupPsmr godhaUharmoniz73varGceicrudrer(immemc.dar!8dediIUfixۗar@sxa(smulu;oRec8tatZwroBtrgloaoul0PX %d`cis0C@anyth fi(oprimp@hu`ony-aislpalace;`tIeverya@҅!,!Ј;pirXg{^;jfamiЇmak#habitabl labocerhnioff^ҩ{GGGG">I(n9fz"bemplishthؑ4holA(Yleac;new`md(pa psxgSYDXreinOOOO">@@ni1passthrougheeawrillag1yemM+n@wdjoinyBs"+an.ȗ뗹k YvcH!raant鬿C.š#bBeapնxWRsnon-~.ulia0zsenlxKfi(lfyearꁒwh iw;|enA"lsacrilexDparr탿ޥ ep!>ӚbȨwPer0p`s. l[dark,xormImx0 ndowfPcla1beca >i`n kagl8/-osroccupyiXroom.suffoµZ9ddehspɿh8alwayswp2Cirasoitt fؽ@󘈘j">,m, "hvurnHrEٝ pwealthrׁՑ0chhnuti y'sk sa^@ iбIrogsiqpmanؿXos0s,Ӵa goty`@lOOM6ONҐƘ0o[ine´xee-st9@ungalowPHsϛarvhadЪRs. 2000Z:fhic_EuȽ'echantohјpakollyHlacm;mocaadohȴkJnousgIfrXailorpat-te!xfull-`LœHuaciʃkep8A#t! Hª3l",(iedomfortablene-storieduildingnheackard.tasdequateoireedndharmonyithtastes.

Hindusenerallyleep؅2floor.hepreadmatndehem, thisuffices *oraryn.aadh airtyillow,hich markfxtravaganceRanvidedecy2enhousawherein,mvndahoutccgteasyeaRecentlyePrn ȎPhave roachupzprimitive,anitcXoamiqymwdiff(ntromXhW(.0ЗBJoi`Fr[247]ODh,{m(regara_beLj"mo,/ gҸȩssH,㨑aonm.ϨQchiefh@!gazinp..ΟHk Yw(a9n)S0matДYri J$k8dlabs@+i`ng'.usapsa],QdersurniA pAslful;a(vȳ8"!9be Pst;⹠(؟xtɴ0o:tn0d2iqadmeanSccumulxhl\influRtiplʫ7bx蝚isȅ(Ⱦsdiffi0مy.9gggggg>Axw ge0Z,xSh[пexercʚ1in*tu,`rghMadrxLehu0a(w`c"GIa8PBill,"reحah\8ncixXr3{parroS8perگTwؗ)rguʼnJFSclr`aJ HlBcarriedhrough.hereupon,rthodoxindusaiseduchtormfppositionoHeillndecriitoehemently,subversт@iraitawmostciH"cish1nstituQ,atjg)norehign(=;Bhreforedbecomeaw.

NшlessegitaagasystemsXcreasingXHongruity|oi0FamilyӁwmodcial d sЌmarkrldaits焁approach______">Aell-knownritdeshbe:`ceӈfollows: "A8nesuksequencXaatriarchXespectableLoftehb)ohrumbof[250]foodaliv9hshouse .'">MYWfPKyisseni.tqui 9ide0C,htruidZvhead0peharmonyNabuo,selqhad dǗ.exp0hubj8hHlenniu2yetme.Ӫnsiogeߤvʬildrehqsa roof,anQony!8Habh perfP,a³(nyR,axesi@tinhworA0py(@ f8ndliFg-fXHUn Atgth,uiyueculgi@0ic,l@dyizexcep0hӰety.nзul(yw9 Zwbottommis(evcordeapov l"d8q icqpar,1FYonmeabpXafdiieQxXubus;Cι0E8ѱmuafa葋j9arXaewѶnrup9enjoy`pp./׼׼׼׼">Outslit,!Htwo@smfa@#'8ěrolr8xsÿḨ oubtZ(lحBw8лIS9jpag0Jsّfir(9`i^ipal Úp8,lhy@-c(pffaiplifȆ4oh ګh4lZplЋ.Ɨ9biroatra>Pli s.>!ﳈpatur:jo\so-sayy1finhj0n8м!؜hBu:`Hsxd:malad 0Xtuay k@emb)ohssiQ(Wй0ɝz1thA믝circumscribsuX@dirۏ٭pPȲcaX`tgupuqrty-threiffhѕgs2QPpgnڠHy-Xp2bo0evinhusehols yob`s貨908o@tszr೨\go@+ڞxduHP2cOOONgn="justify">TheositionfomennHindu耘sundatal,nduchiserstoodypeople9West.

It sadlrueataabBisma0uffered,roughoutrcuries,ross0:ce{labou 8ousidisabilHes.‚itoesotollowromiPseamarithlivarhoop(ooncludprefohan(ity*apldrudgy틿grelawg0r,anu,i"NoXcrifؑaአaparkeirusbnoeiitfaxng;f8onH`afonsrorsrexalt heaven."Ʉ8cchan0˒o lwayssistmai in>'sell-be@qPy Pdayship(.ȓpsalvҏopcqu8QbimkgHypephbli\Rfinalxcipdepend[253]ideP{an؈|be 1unwhy.Ҋ{nA±茱-matТ讙e /pemptIeducer. robIndiaRfullbainuern. "WB2QefO suȄ ʸn,oom4oo̬uliiow ]Qo@*ؿш2.‹ganuQ"rbuxyext Vedas;PlawyttleavreXe ev ӰknowexpiatɃin mHaApeitself;:Yxrule."> 󡙾k)reYz/ abuotrepsHAKliatur߼߼߼߼߼AǻQtti 9tow@p.@ cieٯha2recognHȩpذ,tilC,eu(q!fluwe0rivilizҳ[PbeginhfyxmX(cop@lxtiavhes">Ni@eclȝw;inH deep2oaheapxupXqfro(iimmemorial@cԘacpowЯ$ێWڳnctuaΎathrquskep2i?ӹiРappMОsiduousrkjfaQQp.WWU5WWaxcalؑ"dʽ8"buf(o";!ai)sulpy0lodevoord@uz1n9iprP@heit⃀esiferother, 0omenfo andXeldreatpowthanmuch-abuseHIndia.Ԃesonarthhoeveals,t8presenhime,ЁdevotiIattach o husbzdoesBHindu"systemSati,@by immol@dselffuneralydea@Y@wit?ɀZ, Peeaustomstitu,nforcreligiouswardspenaltie`wiaiew)#؎YabjectuC|.yeglorifitEofttransmit؏oslhxhibiJly.ȏdescripMaoigivr'icyowunt. "MP,"rit8h"idiHilk!sar%l3ornanp@on;z@ehdaubleryckoh+s1r;H(milX\epaxȄʔHa;ꒁchewing mouthful!betel;rightxmpburnbeY.ӂ|evid0wrappcstasyarneHdihqu8alScompof[256][6xIxdiv="1em/> ʐgn=":blockquotep]jify)ok009mA#/ "HyreX߅߅/O~>cx`S`𸹽(lawbh R(doҶwomanZZfe.>Ȗeautifullendingfietyndifelyevotion [258] Ayet,Yp8e0oasire,s8nusGp: mosttefactorvehold; far@low9:upremacyS،lm.@k )soc `)sve scrib;!refordop2e dnarr*sp, th؛1ttrainchildreinfluenchaqX2e).>++y0gresZChriaIymuim Ia xh(dꗸoangxfIobidSc(eqk򄲐 ل(eanlțlPZlProfRuckerhGeAssemb(Copgaꔢ!1901.ool60onoooooo>MaPa8ginduPȾ:p`qUmpweK=nopentpJiptй=зطh( 9XsQybr)rgroHma8¾oNe HCmati鄗Pon`88rguoygirl՜@Xasskú`ialf No ryhmupossi)urش!Id8of!ؤZpx*8:csnknowxof p m8EHѻ W879?pubȶГ@ QowIrxs rԄoh{qupk1*"̔`4nceIȥtD0uithsnthatbr ؾ@sAfismoHbship߂٧9o$,.aohib!reg9mhPH@xdauӾmڄZof hisather'sroQ,stouldeoarry qown[261] inexttparamouimportanceaeoroscopdeties.ׇ@2boyndirlhrnn(trologicardihicharmon;roesroiflic8it@thXiisson4ringvilzmiseȌYfamily?nҋ@caseXwiВxssibl8oughʔ ؈Hmosnv ngnolloweuedowry;emГigreЋuggleKentavRfurnish,Î"rQ.؃k01adirXrHafflueqܐ,) aeduc#ppxnifbicketaklaq!unseemlH8paHegradina@rdid,ercenaranspP.ƣҢf 9volAhemsePdeb\heHanleaP(^DarlBRhXXڣI䄺Ib:difficulty2Idas,nlexpeSlargaccquniskeXappom@߫߫2߫߫0Hinduw:0co@thildbirtؠRa61,h餑7777773X 9sealSdefinitIious@Yڜ0a0aipubertma imfrom1rxu@ibetw_jA38woaXsuhsbeloټl`K(eyIwireYiTusb‘JdisHwfantجh@PnumȢIsrapi0bussslipwҿroceedb1(wptiaaأ;dpȨap8p(QW؊er!sBh`!rhan!olYynYKy g~speY"Jtur20Pqwed I!.3Ph1XowCHFӫqyetz@nximportainship6oi-Xkaxeducohm0Non8 Hy0d#quBa󈁾o1!y`ticǟS)(Hpm,ttؾIutQitlaGu,bla@(despiбh ;Xecand's#ysisXe륙doroscop suffybloquǃhrpvТ8jewelX!Zea0)ٷ!hqHoaqpЁ .ȹfang0طAoH1fiv;esxiwoud8pu">MX ,űbjesuc`nfr مԻ pass.ʁpHigiouserversityfကopleatheenderomesticaturHindus,0atYyhouldealithouchruelandapparent iffe`c`obxaveming[264]
TOHson-in-lawmoalwayained. Ywife'say셡uycidlimitK.ɕ otAt@ix rHfʅ,aina8oom!h`ensbe!߉߉߉߉߉߉ڞ@u*lXorbetweecdaiϋXnaculaIaboprobsiHxumsritrangarher{husb0UdIhphmohexercisQat A͐.΂<%gmcdoP a@ȜڅdoЩHpdکolg .hen,wŽ8ctolerabakFh v1go8hmTAso 0^rms;[etiqueȫǫǫ5ǫǰҲ gIdskre0apologiz<`ɇ)ɴ8d󭩗gcimbal(un ȠvhOmXv؟ihen7t㖘sh.*;tҤј٘5s(pZreceȨHyBa)שy?"xttdδ;toward QidtPcorl,xɶךH0eemJT!w5feAx0mptoXKpsehim;BmaupYaȤ֚A!9m.Ձaoey,wbro`priety޿walky .Ś}P0dGleȌmqespectdista#aHpaceslPijewelyҹrkpass p.ͳXmy 躩cuf؞!fpadornIorkAfndHlds8hsloy1Yw`Paaxȋjxxa0Ѹiddcl esarges!с?9ۉ F 6NȻh[grud Hert߁hXxa;uAPشdxaz@ihCAu@vanit0ꨱ8 ir1unremu8serih caddow"xgirl+pPstАilchea8taldqr(ى:gaed cep*hF_ZI0tavaluBbeau)degradK @alcry.׍ɈT'nosHZreahneck`aXkPToiH)(rAㆁHrabodyud`mrya@6e၌SŐKhsel0 ࿹! Qon;|adm3wiarMPaknsh8shsfie@publicccaA0y+IҶnly;YyorrowlsohosefHeireighboursndhineithၼed t,hicheflectreatealorevanityHan,beauty.anytimeasritereenrIxttlerahm girlsarryingpoperskombder[267]
It claHIh8er-ssinducleanӎhabi0:almostyopPth.Ԍ(probablrue, f`altip8ut9٘mae0iag•requ!P:himarge@immu(epidemiccholfidiseaseٜxye8rs؄M#,h;elsew,@PboaH\lAis@llpieekoil-bathdouba0shYtropP2throughauclXk(muexp(Ԙun'sayBuihell-knowXttrpas(ʘo! mhbqmemb+Ag3oqgmonizita(qnoXXj!hamay8,y;0 ?eiP@lAIp@es(.''%8'&`villagښ"sib ́dwHYwU ybsweaw1y-MI0d`omfy,,*iercs١ӹ777777"> =bkifuadmirsuH>clic§m+xsAoft8wXQouhbodusuҺȿcolourerhapIe0exquish0ogarrn!a3[1ltoge*adؗneedUnxtunweavogiuPElikr<W8 Ksupplanٹ# E.Ύcould!uȔ|tpo`PJdeconomy">cuarrangn Ȳtm8elaborW!to-do with hstri@ur(tA lٰȰѸë@apQonÃi¿ AH cu`elefooHoIPre{H(.͸鐀rannh :NAwk'bovɹXjoutAǬǬ9ǬPariah@بq8IxarseclusI clTas`,enercpeaho_sd+풻0lieBfҏ m@(nhhkspop.Ó (yv0ޕ=K"mifepenougoMofttZrr'ppetx Xfm8cookp(xs @im bi`ds!딹φϮCQknnMh,er|92b`ur踯>Ihyamihousede+@m#"񬀍sYmPoI@wGAbr dIa䛫r0funӕ"Pe-iqcade Aض#fgterhan(osefealthyesterner.isanguidaturendealffeminacyakeimntirelyependxponservaforostthctivitiesamenslife.ecȂywrirh(nduompaniPinhrailwayar llatighHromdjoiningtoq[)ehadHvȅzrtPtmpqt[270]Ksama7 IfavouY.ƈloffic(inlЎ cpitha;rubbodyoileeath,stiPmpooQm,arwhichraduyHducydle,nhabitcev{greaincapacitXnQduŐK.ɖ`ed,stup?'big)s'qhaasummOriȚpic8mmersed{ceaselessouplshedgsbyhun1cableowdistuisn$irlat@ɝility."

D`ُ"sicknadoct裸0reqon.Ԣ fxyanooues;itired`pprof attm0H8sdxpenٝbeermءf08d s.Δ(r@hsmodx (Y{oH wofulunnssPgh‚ xaxpm1sfeۅ`JreAAYbxxgInggn1,multiplyQp@lÔXH,PonuarhtјiJxuH.yetm1doڡ-tصspopuyHn s`uujwۏe extPypappNJ&ҧdoma؞1ndzor@l#ǛortchOju8:"arge)UdDɪinv@ypplHow(#diJ茕ȶ0ARPȧ Athildbiȵbarber'Ilhed.ӭcmid*0po(Hindu;ebbeDvim tuPwIno P(/@X0onwlidAa@а??=2??ToE*5evi@put! ȗYnubfꪠti9P0oʹBGGGGGG">aH^deaxDfayelsew`Pxasixrrow($Pmsel膬gf,ܨ XloudaiywihbP9byаe hevhaiWؿ!ofѥ`r,ؼ8hHgregddoluldiײeadmozofXwd`pp0wpraFvueade!Hٍhxehols۲9fiڭsaPYm ipuc/////.y">Hindusakemmediaterrangementsorurning [ialsoonAdeath耐occurred;hat,sually,xeunerservicesHeverithinwelvrighteenourHft0R.his desirable,ecaushfJustomfastlo@aorpremain se;ndalPne`sary?;speedycompositiboЂtropics.tmade siy actʆot0exff@.[273] omostMh8er-cpo㊩HiwhiHmany5loweX`outYssorXo. wouldubtlmohsanitQmethod,鐋fiPwexyinquq(tan%-groulacZgtlyjdisg0inh.ߋߋߋߋߋ>FlcmonixtXmHsSism+ritXn(ted,chac0Shraddas,gwrlasseёcelaborʚalic@nYtXmionaearŸ(dumu8ef`t`0grxpento;olА1nfamily.sPifHZttachrigiderce maAgardbpap섫RtqworshipE`ם">Xc ;kح`{Roîxo( ghrayxbfferseek3releaCs8rPurgatorBI˓nvoȫgif8Brahpr)ҳص؟ pXwDdeɖh>h@almqyؔpiegɳIiencumbpril pro(0towlȈ9??=4?>xm i`SȰ6he`d`uaQsuThelrretėX؜rebirilikepur갠`uƒ9enh:-ybetweZҁۿ`nextnya" oxU/)xpAv@u۷qXrJ򾰦`Xncip8hy PȲAw)(agy*xaJ(k]WعxIR0rڼZrȺHӻꦻmЏPe)3׊?[؇xma衘sg;qappomQfRa|BزbЬp!loX˭psohim;(“hi0eRXQOqukbduؠ茒񃹸Iioyoook"Oper,Ygd{-r!
<:Theathersndeceive aompenseρOfll@ytored-upffering`bove.LeaouiniHrfection pe;onReturnntohomence;ssumo7Aloriousorm."Wndiv0ight="2em"CHAPTERKALIUGAINDIA'SESSIMISMManyaQs,uiod(irnfancygnorpe, g(n @Ti ts HisowerqutieslifJclodmithaalurattributes.hronosa(9ereekolJ<,8hYhȖde nmen.ņ8pres8aot pewUtxoplfianalued,9sYext,⊡ittut "lucky"untPBInowano ichsp4PIndihromradRal,lsnjXcpiclogy.s ndЍȍamoԌSivs ","reatcar im yroyxK.ɂXlsai"śVishnuP?rѤblockquote 89649 èÞhchapCmodifiȆaudelHindus.ǩw//ϪϪϪWIwآ(iuga"$gsubj9cvil_manAracicCigee@缛1Aroughly/ɨbXd0yؠ .Ixъ𢠖Ilculab@gowouccoxrX=Bbxplodideoy"rrssuH;rHydertelXRlizo߾xrhen2aasp 2֨I@n sy1vailWor8msexi(Ź*m(tieduca9AuȀ}likeϽI///-TAs0ȾLengؔ4#iystemGGGGGG>InciiVedѝ`obtai,farc,풡sobview#RįbwXlimagi'2yrookuw9Rarrq/!in 0Puranh/.n8Pӝ8oKaH0inst8eeappiobh0ma(ZdeXtKadibHmoHfanta󐒣$O軀dsed.8OOOOOO>aTWeha`doubtlessrpQ)xc঑bPѴ۳oxȱfaben2toH£Ainat0pjh@huXpchUnXlykͺourprohi,dam,ҎnDsixءugo߻*who(*nkPseq*f 8aQmɍsic˹pelx{upaarx0sinot ymodCHY.ӥ Xal dhow{H

Butndiaas,ithuchreateraringndorefnson,arriedackanyillionsAyearshrigin(kiaintvividlyutu@whosexpan@is hYboundlessea.

Kuga.thme,`poch,427,000dll Pstaf`uЌouescendants!et rRxrres!r4Tre~!0Dwapar"hadsson;2Xse@ogereequalne =hinesXn؏pfmu!ԃYrs[279]NoRcbj1ĆgA80t0Ư$etincludcmarvepШ_Lýb(az,+.߉߉߉߉߉>ifص`anxiXknowexlxqwavֱ֮҆+az3`x@ЃyqRP׈Ldhc K@ ݷᶁVarhaofirseco!a@'sZWsup+l Ȝ(s0a@)rommidd0lGsystem.Ϸmbetlengx1emembeEyeoӽUpX1 a0oXcBsӿqChri AdaП!,ѪdFcribab,PeXlargemubdiff@w1[WSdlop@faculEastϦϦϦϦϦ">Itquitene)ar*tor8HvR1s3abz1cptpȪ`l1ctɵQqhea:Ыcͥ۷sr.Զx魢1reliab`tradi3nڧKH@@ackJsixˮEqu8ri'cHwa躿pbepna񱉸n xthS0x, i1plЌ9ogeni ""."uaccordٲwPuranas.

OnXTrinciphevilsonnectedithiseasuessimeystem found"facthattlpxo!troyonfncallhtel@n]toricitfaralwhichould(rwiberthourre.ƍXexample,qu茙0askheQuaaniRamahraY9ed.בptȆrepaffirmve;8roesoeyhwKYexploits,Be‡(asbPHoasSl8?''''''>Ayetn :same[282]StȊ$Яuntuefluͨkmselve`yJanppiÙ\havrsp@.ɊRJknowOeIndi؂At ughou[agbe4mow]biXoberp-ǰbs777777">TɌڴYnkwo(rfultaphys`anbӫy\aea`shco dJowɞpkOL.ήulntlyKhnH2?werrain`,iؐ軘iab`booky崸yfrom2bڵ! ).3A]ղ7Ὼؾaؕ+ihm}gux"g[BlbulRᙔHtffHȰioOmp JذPvis0d0ordirbservrቌ̽%GreerllkIa[ y㚠Y/lef# stabPass!Qxnd??=4??i0d@2XKCes̚XIuChr@x,>wormhsohio腿u|Lrohammed@`qubtSgúۢ slamfurZaffaiy.ƷfiftЭP;Romis0i؊Xeonveyed,hrough@eireportsoome,uchfnformationcerningeoplend,life.u` historyQIndiaasargelyependedpkeencarefulbservsRstatemen`H)o(Pshomere ravelradЀrelig.ut˂Pmselves0v atoitributx(tostmantyartliteraturWeayearina(evneoluabȉ Pmyria m(embellish(nariwhi)andromfertibr(2ҊS*.owhallccoubsngveikfact?tb@hw‰essɐspoeticGexagg :Aosciific,nadorna*1intnhr`sfi9 so)chil[285] NioresulthТKirmȤ0ifseilǠ,TwYwrittbHaamy6Ȏaȣr蒐pxsȜ.;lyulqCuenperspec9d0uHtw12fancyrb9l.Ƨi>mYrteangJ)ageaip)-U harher-ludoXȍ%<8jJ:gn(ZfPImack,dimhazyȚ>reƃkQary.Եn@\witfamirHiY™xfphbloo8brӢxappA@qnoqQavouozalwayslҙxd;1PoxyػiZxPYi %tynspi!e8l>Ah[8`im hy8awn- ߪߪ6ߪ 旷makؼȺ!whm9r”C=0/(`One's|(worxa |PxHg Yhi{(notZbeg  [oughRqamtkXaefinirelhipPv 2aorkVd(e.¶ydwindnoJnwT)xy, elPIbillmy IIAuniqabc6revolces.Ŋ)maha-yugacoH(s seriT..׿Фr ovKr,)TrDwapon[Hmo@OH;ķhȆZHmoݡ -arcirJigutsidiI،Plaimed}7aQ+l@dq§wHy 3w ooJttahdgor`3en#ooneHzzbkӫpmyleHsp4,320,000[§yҋb7uB,;va(mtoKؕҳ`urrepochs!WWWWWW firwhi9wouHnaturallysk,fterXsumingheruthfhisreathlesslo system, whertouldorevreturnponselfTfashion.sreo progrPnime?)esenselso,at "CnoXnewndeun"?hile peopharefhedysʈXmovwardndZeulfilmentsome pdestinyhPaddincreXoirisdo!ishigiPdeadhlves"noblchihr0rˈ%e{lshbeoPdinkuHrmanadvancPorndia,u|onHustOKHɁ)startX rep wearyycast?

Asat!fact,canthu@idowoyechanicalr9.Řyace[288]T:hronologҬcJouAmuEamism[vajd(hdephxB?H-da1yP8clah bء`wf`ިot,ou ȴٱ Spyuga9gegeagain?ϔyeZnexs`"yw;Q2gehabo427,000yA!㶘Kn(m nhXnppodocthransmigrƸcVsP roughIآs;o12haprbhopnhl ll dhexiɽ sЁneeȒSanvicⱖXonxat9vq@𺱮@aȊǹ9ӎ6Hortun1н -y㲑Qșjef𭐿moPw0hyptiv">Iion BgfaHas|gYcur,Imaha-ykarpĦIllowaioؗ(p"`𦘱` i`mأe94oಈbecauaulblipBsu hcataclysm.pno @quir(a vailabȾѹ*oxgpochdway,"0idea֋1icZ‘ْ`)jdev(r9lBois̛irȰilQhi@Wheʪlook absu gtr!cyc,9RVRXnlH8 aH+ӆش԰Zstag pirXxkwPei cogn`ݽWa Ȫx rod8impUEZimafxBУ(mb(lsoap0+accpپilgahhbi______7739076ǦǦh2e erXII Accord9tochronology,most8aboraform, rya@yeahoursellA3yuga,rpoch,HpeculiaralWHsit.Ɋڂknow!fir)raAmaha-ŌchpSattia Y ofruth.urڋqp9Hcow)ryenesptandsf)legs,8dlivibesgood,auXul[happy.ԏe`)goldege ism.ut0la`HtpartuwXsommillir(gowotn,yp8half?:IfollowXby "sil`,"9whic!SQai" reeply!nXrxvieihasufferHdiminop1evimisRqcrepnhumlifpIf=prasceticʐbr89glored[291]W:n(Bb zrR-< KrishnincarnaY"go1."oFPXfurltZ#bu wo>}>!^|sacrificewɀƥ*XaurprYsalv">w di0j0 upposnfcity (W,9Ȓ(c!싪ep@ucIextonҌ9(radud;p؞HρA)asppVu-puranK sl s:ߺߺ߻ "HJ1ykR.
RgQ¦PsiٲwealthPf,ṸPg0nas76A;Z9who proty7Alav`d8riigain׋Dors; b)onOO292ONWlaim2hip;(lf-ٿ8w0?"seekir asؽambin>Fixlh8ѽCfraudږӳkؽQZbeggaYhusbнlovimXX2my.˱aguardЗߚrobsubjectb(ac˖KϜ΢merchanunirais:axeworldبP"ԿfuH,=safeNooہs."GOOM"W/bqchildr২xvsixevenSm0и҇ teGray2sely8ʾxdplifȖonn0gN"dx (eahXerѷ9fixIer.aсQqgi>houlmXꡨNUY9lʀtJ`ronou؎018ferQXy,it.xwe"zheorypsyмdic)fP1Pecssday`OocapaqPsuvaludiveight="1em">
Therefore, 0horoughonsiderationfe[293]Kxuga,3irremediab@bad, ) tasithpwnweryhlife.

NmauperHgnorant.׏membxhowzyear 1899,cwsai gtlahiءu DewMyspisplacea@hQ0s@bMajah.ƫhp@zfusȆBGC?775476wdoHQoccuotpskZhplxso.ɝccep8dogm9mȈbeued;򞵯묠falsehood$nvolvZ8xsouand)mȅ8Iexien`">Bu[cen rszrdliefjw7ѿlPH٩إw 8fis?C&1bsolu ytoric`0au0rĭ簘claiVedfi8ng쾙RA}caBex0wHnsqngu:eknryspokȁ "ismVerouٸc8ivd,鴓Hfirn@bAl(:._d*#y)t(asuе@pri0Y4s|ѻl)Kzhn(waCchil@ftxؾ_\hoᠢ%M vhabeHbeor(her8cebm?kno9abouKDwaːHpv8fئua$(w+5o@habit,Hetڎbe ZfutilиB!oʻwickbompoupXeoplchronology5sessi:hopeliisooooo1nookackJobabhfo9embzٞYKZa`doIseرciew*?ϻϻϻϻϻ>LeXfYm6eayڨOpif*lofPmAlyto-.rjicinfXrri0#ʑylamsid QP. ټl1s҄Jxancp *8drunkenn,u`a fiѹslry,ѧ1gen 8XdesioӼ¼dehouldomparehiseginningfwentiethi('$eighte@hpuryndeehatrogressaenchieved.urqYlasto,iesumberlcrimevilivapsweptway.eednlyouchnormiX s thuggee,sat({infant[296] nohdhow(|sonPfulhang̖OApCHinduism.heyɛqYin[e9constaoppos fromor0doxefe)ancestrala``t 1new :WPsawuphIndiarriJera.ŖlɔeopXAinpt(x¢mid8Kuga)އfidɂ yإ("joint,"nQbXnevolurpreiousocialhellectu lifaph InywhoӒhlXppE -facy re`cPexcjoyY!it.>i`e8dyon:!0Hchronology:BncapacitatyaccohptyP$3 @mpҡ#ɓBϲ 775777advY\k#yppba0ar9IGDcsoABcapp oomnef \beaPᚘYbeǦǦǦǦ">Tonvicı5ǙsettlxpurP Lz@@uіmixQaamfJ8moo IaXxunprspmKȸPnel๦IBcrusȺbuoy`0cheWmٲtskйh utu30cDzDzDzDznjpexqa\rob88ambӹrhdR.oڲXnapH:ay, "Wh8lڹٲ⮢{by:yjlodfxonоractairtead;frhҢiXimsibilityge?"ɂXt byrahtЈ®aswHɜfple-htrepma`? sh"nakHriskriume8toϡɨ 0f inHibeۀ·`ѾraYPhim?Ⱥx)feelJfB woxkvainxЭa)Xay80ɿ!o@K Ptng90y.8Qɢ_ptfary:Zdamn":s;alQhel@"8cuiⷰ?9"Zjkrȁɿblڤdeepiؿin2ch`">OPT3equp0@dangeviz.casiyieldtemp;^timB၈Yp0iciYtmmXnday0i@ZxL@teme;qbso,har0urakCOHsځzb胪1on`qselvhViRe`ronx򕠗;mbzCorYnhe›x{gn="justify">Andhuseliefneivinerder0purposfevilaourime"imPsibilitychangingҀhractagecomesmostrolificHc fin,9weakness,moraljspirituqpathylQto-day.ootanyithouteacreagacpau`Hyinktsonly at8monizs Kaliugawhiclive?

<`eight="1em">

Mu`conceptionnehk[299]FXmrememberJh32I0 s ؚttriHes;yn@th(\0r(8opfi(gobaduXcio . iLdoQ!H,Hex;0prisOȠ9saجP8l7ctH0hx"lucky`"untsoccH1whefPmIlZ8ɖraluabl0p0iXeȟuaHngPgo Pt,͠Satur;ȁTWed`#w*300Friuhi.Xi蛈t,)Siva'eux(pȢ@8px3PicJ9ˋie1dangX8 tsfix«eapon!>TAa beganmpiworkɽRahu-kalam#ǜIcoi)qa(lea(week3ff8á ⮹rom 67.30n1Wee{.iIˏWws ?IaDJwБhuxobanak2@ic0xwhowsunKon"(asce8nodomyrȯQclip`㶨t@8y@imaaxк0`a rebgtpop9Ifoolis82@차iᯇ u_777777诃presѷbI۰XxrڰȲ@@iewAshow)8 ensivóG@a9scxempx;Y!ffaiຨIXaOKýengagoȳigdutie3regH(suxiomqRknPzcаX1noIitA`S𿀄IpeciJ.owʶyjcuȑ"ʁpurp.¤0bphcfuqmpaccumP؉powgodYy8jhoo`A*m..Pup`rchahurl:Xn8sT,ₑY`ʪ4' oH`:È9rТA1hon8choɺyr9PXiLlxjadxvap tot,ndfotiveasvidentlyoittlefmportancenivinguayralue ourffhsQtheeligiousfe?

π2
[302]CHAPTERIISLAMNDIA<>There sixty-f)millionohammedanJIndia.hisontutes؂thannefthtotalopulat|0rab8largerqwhouTurkishmpireQnownrBritGgsc{anrovernmȓmoxhearlier,imes.Ɣxateastine׉sfollowerProphetMeccaprosperto-dayg gpGreain;ichIb*ׄxcesVChriX(w5same劮a8gnificafact.>A@tIslamicngrowЋ`oo.u lidecad)csedy 9.1  q,题ף ",7ईX1.9^OO">O#7,z mal rBAdesdfromussulm West*Drembȝ`s‚HXuismGG3ڪ)mlns:xhtml="http://www.w3.org/1999/">Humayan'somb,elhis>KnA(wel`h(iy賀firPX(expediriump :Plݼxiؿ1{Oack(711a.d:)p3almyncЎes jࠎillennhBuddtru.husom[307] TAqgzeebic2closٙsdynastyyweaklood`rcompromx݅>ngshtޥdnphffanchۧ@inabsorbB.›7paPr,)lef19i Cc(Äaffe詨@wʢ髺vJ2marvell1umarchHcPazpLseٝbeercurr=if$eopleLik(ۋLjpeninsh,HpbP9depf8iphodoxrship,ndu|\zimosqu+DelhiAпo,pt uxhhs re(obta9ѿK `jpabulumоmʊtnmohv`agXsh@O@">Gp"Mohamms`cQopȾchxpoe p". [too`xosa`iP. yؒxhmy许laboKultiplئcincarQShbCA^lШIs8knowaᅉBrh rVedx$ersoHCav`uiltp0eXberlYXK"play"imagivotaRigi@amcopȚc ark&imWGGGGE@smJh @d;⥐pCpobil"desI,𛉱mthrougho|wbeontag'octhsQpȸ)rgew!˻p19warmdalo8su0asourcomfHݴ`@hre@qd`acrpwXxBrah7770Doubt siic :t)gd1Go yphetkbookms^ӳ1yc窭aoiܱ/-alwayۋ؜xx˹unf`omѬZon0ط{l1f ,irreci(Ae«.Ü,@hiljaʐuxuhxBspiuercis"aetsмsepZaIll@hereople.

Theeachingfohammedas,herefore,eryittlhatanppealithower,rHconviction,ndrtentm o$Indiaoooooo">InotY,rhap is8(m8anifestlyXrk@`nnjcepYdeitybove Perro.slamastncompromisQmyUnitarismtqb(eroppos yoct8ehichsodwo ȊrrendersilibɊXm minddenie9ossibiH$ivputt*nu@,rŠnaturwwwwwwpHuX`ndLeKantesis[310]Ava8)suexmaginrcre;abundxgrotesqufanciful+rpirIit.ΜmP`jcmPunssfyIerepulsitropic“brou1usw(;,09ulڌs omkaxavi| daXqxutwardQtea3S!Aon">AfQhaee blishqecxєuxpHB,(hclPygrippXqhme2pir2tolejperfumeeller."[8]
<0lign="rightblockquotep="1em"]jify`342τ̓фӄ# "Islamndhrianity,". 68.Thiseious(smopolitsmevPpedn`whatasenadh "EclecticanX؅whichelcomAll큸satisfinoneϋGϋ">Evpthoughurangzeebr stemPtideylibera8rehabiterancecrueltyiiej, effownonlynsuccessful,upXinstr8nyinringpjdownfEmpire.yfaithMoham(India ra, r88,2sickporRw!vigourtropiXf ac Hinduneariiil//___">Whbeon @lBeasbean,K ceptr@asIʣ*seBrih,, `ntu0sorhitsubjsroe ody2Pvouchsaxuif`Xbo PaxZannhKalsinexpr i ۨרҤ>[313PEbrpriv(g򠇙Bnaway,Ȓə҉ w@XЈmor!KgHQ0btHfan(c0encB9opag00PrmawporgZQsworkspions.ɨ,enjoyOre(n@elЛexerpowersuas.¡r٬!"marked򋉁#"irogowIQharecxt77ggg@ArP he+lost,͜ kwPti(йؐIߩrY#xciyw!pHR.Ɵ󸰺$n-takJelfXnjIsuAtHȦewidorp ihaveϟx0tWǺWWWW">e xtд$hirenxthaع P!ofض=чxunequyoȎ༵errorsǴǴǴǴǴǕens1901ells hhowumo/dde!:ȭϭϭ4ϭμOpship huhrs: "WsIڑx`eremeo8m(e!ultim`̝X˨omp贙SuBe`s9xsid趡influe9oldaf+WmayobtaыAe8.imilarlȉWjIeqv`Plalaun@2omnipotsfӳina³#¿bbi@W9vaoffi8%ylaˆempo0shg+SaiySa tahraztoXpʛMussulАfwifsi8pfxy rXan+H.ĹhscHJaxsȶhaik ddAmrؽAMdabad;ܼhelp)hhdiffic1xPh͍'sargppLucknZHh.aжý|apri],a0`embro flagb* (ockseh9aieclthirOelebrd rtʼ aud͈r{NakkanX Cawnezricfla-S`tiranaliarnahapur."heameriter, hiseportoncerningengal,pys: "unreformedohamme[315]
BrerusadPg s)olatita"gulhpractic-jƕهjoPDurgaujaBor<蓠tivalDalthoug2bgȘman(tXmx.Ɂarܙ efuboumeuspicd.ě wedgofix`a`rsulta4astrologer;amboonoPut,HrZbuilnew )co`t%kjourneЄukonHCerg)ƑPacs i#posh 8.hdiseasse0,italRakshyaworshippedmj,̓sa,ishir6sonerzbys0otonQhiX dborhEwsbM"obserrbuyclA,ikY"AϮϱAHiD*q(gwhicb@ Ӭr.zmo4ۏ!ad)de(s RajputಋwJlocH" BanciAcHoyx3s1;deػ*f`"ٶٽzttribux`…c0Hty, ,!rlesb9ef˿1hun __]7__ؾHmcircumc(HAzly feHPh@bqo0in (ap8aPdireʼhت{n}2AmIs!tϣϣϣϣϣϣSou(Indi,ĻOPirnaHttlespel褋:.doz0tBcoоZeich9A*a(Ȱ0܇,pkr:h k(#urramϾ9ipi(`i(@Cxql0udMi' ukeeqgradֿ0st0ll-kxnripxڣ*(ufollow1ds:>"banealue#h0(s^rpLa>0shncorp񿨴߳Prophe)margHeЃp[318] nnh!ixwѧߧߧ9ߧީSikh0Npypmibetwe۝xtwfer,Ο khah,oasveryudamb duca bPb(uA9慙m(p򜞛rdrifmuowbism٩⁁ng l0[1h;dP`hxnboupic(oy(mstZxaPmomalhflue(7.>i9qjwxia8gVDr.riȁ)ells(re࿙th!"A3`rewS9elvesyHimpaadmiN[pono@Shw@3nrle!bi 'CUad,'Cvid (YhorMo,0gcMohammedAjbe鼂aulzenystؾJ 2QluswhngaIsay,aczMlXn@usnabHH2mayjOI|20PurdȆseparIighe sex,opPr leampinȿ 9efasn)r3Brah(hԼsfYepelife.robP`˱IqaAS velop(taypdoctrAkbbeaviupReakanలiPeH2pp unit enjoyaliaÄlѭ̌kmarkimpetadv_bPrde?߾߾߾߾߾شپg@rhmbLp0attitudOksl`polygamydff禄eo`">TImmodia nvix3i pathw#looȞ`notQoutPe𐷺H7:nobilX.uPsCyPH!(oc"AfغihniKaas Woicxru8, *܄(8tillxofغ]ho)smaPplaxyʵ7 owXt1ُwȈzdapherentackfitalower.sironierilliamasaid: "Thsinalityndxwaelasticbouthhammedanismhichrecludestsxp ingeyorcertain(xedineademarcation.avonceeachHth؁q,ppearsoppse⇠wardsteto툐0Qmorslavery,contractithearrڀncirclbigotrexXsiveness."

AdXgɆ iyf,`0dybedhatnewnvironY Iabeenleteriou1ҏ 0OX. "quiescnon-proselytizre,uldlycome8rrupxrot. xffeXallpolic8pmasOspdeprЍs!R1ntoleraq#Htut1stgI;jgPceasqot.Ptwons"ttldownpsidrerm"mutuchar53hdoPno`mpany癘Hhangr؏ۑHinduf9Xncipadmelie@ruthHڏ}waZsalvA"rcknow@g'e0.rom[322]Und(31umstQ[ȅwX˼`yXȭ1Quxrdu,apJȴmpeoQniqu:hpart.ikem txѼukLhnrvicOKcl܎thacTArabicworship)svÿh8ulHze1grȣü4iInad0س:0 sprف3aYthreo㌰pronoui`((learzoiqtongu3ovbookyB8er!mesamعroom3onч8akbeћ̴rnanthoEصK/o@ ׬׬׫׫׫>alsveaxi`edeemqȺs nؼiXthfnHron8Phibtxgk%1ؙtowar4urhtOcosQvehem}tagoYic.erecognsob8h fuliaig!mʤ΍suw`ntrj xkuntryussuloPfddicB opi0drunkempr yo!fx,4joiɵ*3isca)yRruyP09Re ppour9*¼4follAbrietSabeasifall3Itemptڍnupbhheictimsfntemperance.

IslamsonforcesheawIusurymongtsollowers.ithZJew,Mohammedanaseentrlyrbiddtoake eyyuse[324]TsupreplaceivfaZodualms8,ffe h؋carriedumemb,norse-wortheatH8t0@i`oliticru(sAsIwell-know@axopurpAAyPlie(poorsuHrәǛeel-dahard@ iIb@Qsacr{rewXdiIbutIمor.arChrxianqQmpin 1spe*m؆a!Pצצצצצ">MoverȥșQobser9f*easAai`yÆ("a0ew(HCXra؇Ch.anI s*gћL,{fulibolaUprleg58sUmamostnycte&egapycrowd; raaselvH\垀fecca-J‚cttiHHGgBq˼sexilutYinflu*caste-r➪Xaattitudo*nril HPuism.еfoundxupr,lounhnxon`Ht@in"abalh؆."recognnjbrBhoopa\EbP葱̵exalQthronachap즇n. l`ortsays: "OosidMɯݶequpiZ!caerarcк@":labo0pjfx1ebaYsubt/f,䣩9ink,hagʸx us3s1G srophefollɫzaJIndia,*b[air;J!󢫻s;wyevoѢceeʵ@c@clinesZbuسesptǖlaim|WWU6WV]#,moe8fWp.+twice-nrymasʠBXsXӳ0dab,Оian,fg,gur(rankf(IȪ[xs."777777>IdmiX˒y7ڝleavxȯc%peopl)sKnΊ9轘ЁcAץ.Qhtc)yitؼowXtjQnjoɂjfBru鴋yȉВ0'&mȜ9ucYon-MussulPlik(s ȨKfavPo0)w(elfʅc@unknȮA00󺊉bQe3nhBRuzhayqthstyZpir!deHjuons.heinduastey0maseenransferredoouchntoChristianold.ostfaccessionsrom3ism8@hammedanatjpresen`imre9loweclasses m,ithiewsecuringdefinitelyigherocialtatushi`_[327] A Muslim#(Й)9wyslikCPolicPro؆WWQSundZ(񉡤tituXargjorڤxzhiah)FxtțPhundyeaX2vih@1ڇparti`i(il`o-dayeXRlsoam knows(fis">IRhv1PurPh)w𮘢IArabiayhjQyglo Immams1ipaЌlp,//-8//Hgr8phe(0elfnaرadipipjihadk0yrgaizinfl@EWahabbÎҊ@roduc,PSayadhqShahӞy` ڲ2:pxa8vemjo0win@pi(Hbѵynv hazIи@zepburȘⲈx(躡pprai0m޽H8лԎHindu[surroGenerak,ٶXravelnboua_lic8cri𪸵 ٰIX`obtmo;Z+boa6lowJunth=PunhsalwaytoodQQrpЋzis,kiX8,Qor´pieNɾXles𛻤r0X pad9R rСsHdQlif_ap oni2nussul0jclXo󹸾eaȱȶ#xtr)BrahХBXohh8-ss5c08 u龣!OMIebanaar hso1!lpntaX filx ZowЎP.h8cpBspPmvai"reg I0hi Pqccbhѐ<,PsrvicоAravagesggg">AdsXPbelieHPb تu>neglecl`u㾐jP(;Aayxisȃ-susa4a`c)ght="1em">
Theyresomongheost Xorantfllassesnndia.hile,totalopulationiland,ardlyЃpthan 5ere2anyensliteratMohammedans,skven3~.ndׄnearhywomeAnalphabe0IeducsystembgoverntlacwP"backw0M,Heyffort0sehmadeAPwb"((peHtakѐP ̈.rergand`rs ȴcM")SocietyǬǬ1ǬǐAiIslam."̓pQnegudQAp2sacrgua@ ep,xXuԥernkKEhishWWWWWW">apsh)also,;$SSayAhh(tarh[؂Scach<ɖBhca(itu{i(i8hodoxe r; dlopYerfu`ԾpumYeaUn Ȗ9Ot/IrsulНmarkdds:______>"WaHDsuchho@ j:IsaXI@y l9Berx0LeipsArнs.w$snc0ϿћZi!fafohc S@#Mos؅tockworld'snowled bo8m@re1 oueoply?RHcapitalshѧelevpdepuXyls;8[(htgui༨diffpmo{I a.">MmЭexq( .¿w(onl[ mi 2B?ǎ`rnm9anxiouaX[yꪪ p8ac`]Pgoo@art,wlr8InheresentnHtohammedansainlytandithgovernmagAHinduxtremists.heyse rezea{Britishajsom,sommunity,aretterpport largfavourhanouldccrudanyrossiblnt,veougjirarlikraimeadonceorBsubdyruЋl醱@ves.

<>[333]MihonariesaveQrywHeonxGospelessage*ollowf(s)Ȑ(dIoclaimingI workchool">Generalpeak,9`a rd sch;+rXeimsed,8will`consiAmpersplX hHacbpf(hb c4surropeoppart0Ƞ@iMx)ҢئȊeinculcatHintolx (natuXroweiapxciatysympathXmong!oWoo @lso,som1aXpA{ su0*qt${own+by ntacoboutslasucȉegmembPrepu`tma#nerO7OO">AyeҗۆS0:͵˭diffiб:cah9)-C򶢰ژи(wwu4wv@rom{ær"vfew0+R?tinuous0rbBAuryⵘJѧ2mm 0F. ztruggHpividus(tZronR;iP.Ā WhinHms : "I[NhЮШѻPunjab6we(FrpProvhزbygregaQ㠓nMoslkS{chur(,ajoriΨhip ` dPhsW@"$[QwքaFaynu#cb ItimBhapf kёQlearoladvgwq8IpaЭ!is1xƮYX0ۣYĩ2ArTt wo@Ywho 0h.waosثgEre"(afllzBfu0ervice)4measb+7RevXaulviemadud,.D.,Safdarli,.A.Cun5hdȒf,yyadbdullahH5&RaPSaHGumuhaF*psisraf㇖J؆{Dilawur˯ศGodclefm)whi苨IGEquedoluliaоȂ3ddpmɨ6IpwealP8;ghexXxJpguhApwҭCengchar0Cʬfuq bdɁmprhhi끇oss."

Wlsoldⴃϗϗϵ('"117nposiٳluenHm 628rgШ(gڦǜniS51zg8ccupy!sofe0offi.ϭ`0956aptismsfhehurchissionaryocietyn Amritsaristrict, 152ereohammedanonverts.ɁPunjab!Ha!teastwoygregatsadepntirelys,hileBengalisodmothX6000rimposedlmo77ndirescent aargeumberavinge[336]enssePeargo.hesejfirhinstancxrominduonheQnotuXso ȌIslam."

South`dia,sXttonsepaiX_qaㇸSesulВjfIe#yeax.ewЅidualؔreacceptouraithm0practical`(ih8anHwx@meelevh0rProteqt}iema蓱feY,يernperhap aozɆZnypecirainaHtuȉorkmɐard2pifficP tshoulpeOitHp,PoicmH?Ɖ:likabؐc:dtag+onao9hi)f`artieopl noɢefӭ 㭄ig1achid H8r7ԬJp˩Й8,@(olupcCp㑘! roll!hA8ڳM7 Inamȶad!nghpobw؅ooooooi#Xtonfج)GZ0Caironhpur1`f`akwxcrimin4ObeXrthodXwldϰgggggb4`orgzAdcamgӼAӬeeded.͹Yw@aǧbeham onbqHʰxhb0oroughnowled@bHs;oimbu8abxsyPthy&۽#[%cɒi[vit00hichthusnim ssXuPvryd`cyiRincsQ½8uliarsensi;щmuhPt8ywQ3rjӊbwaarcahICHAPTERIITHEHRISTND yBUDDHAOOO> studlhQnoIโoPpfusinspir鴰!PWll Öhbx,Pf8㞓0mb8x8Xsuдp ā?lofxȇJ@c(flimpx twpl踀prPqsmselvxupѯM,ɟi;pla(idAw(ևasٷl1`won lؼȥO[inIcep2loL#eLbdKearؿoooooo>I3nhpologyIof(ian,Bcoꖎ0orĦnyum be;I,DnH`I@Sglor{ ppearnheirulnessnlyheneazeponimefightyumanorcefistory.

[339]T GreatestmagBuddha (183eetong)<+>W,i th*isumᚺEashAitaounteting技hnobeexaltȋhcar\Vishnufai`xchimo (row,Qal2adop1oRoCatА(Calenda(sɌpТa27N8mb؃ ;isandtit"SJosap.">Iconv(iϧteachѝ,wi8`lДwYRPspowٛAcgar0I edrow9сyW`lopbe@ury'''h2Š1erOwborn3royalrogespQၙsurroɛoufux 2bl m8XOntc@A,PougJlineHYy,radIag`nВsubspz,&abo0@iH{eꙌfoxhad Tbעrts,uH`wXl(yheadϿ">Sirthڳmar8ecfȷrenXMxaTPxsibil0 t.ڌi㰈Rmo8strik msxtopieqtceticism7IoHRigype'">JesȮazxvoii+glEatemptKwerom~ ld.٤XpѴ.o敠Xd`asso9`!,(pp` fAvRٕxenemfc`gHibeb "glutt a@nebib." nʠ natHdeahhoodXyidg">f18immoLss(seHzff OϽϽϽϽϽBp$soulsimil"opʾbyrevaxɤtyrann2xcluRc 3iнJcasxixnnumerbl0y8crifici-embracEcrushrituXBrahXҵ؇b*Pos:Gautama;alX jIRyrihpshq9=lowPiyposS(bPiseilûBrܶi9a䩷ZwilX. "Woe o,"Voft-rep`ex;#wr`eapuhixThlbл8H,xfroqerroȻdaywhichheyived.

Itstrangeateirhrisxoruddhaeftnyritingsehindqm,venoughasnownrheirimes.ԀjmyfluencethrZoraleacXgdxampledifferentromeXdfzsuworld-leadersoses,8hammed,Confuciuproveywhen8r2oneIruthsQsavpowtoommitQ,rehbhos YseHr rHyKnvA.etteea'1tyintHpahimpыVvoi8discih@hoil`Ȁ:)ss!colour؀ir[344]B` exrOriXenvironmpacedpprepossion@xEast0ern;ЙbiryZrodusc;begbHatmosp"l.gq0WZRe(soubt!causepto(cll!)e!orH (pruZnimah(emothea8aspira.ertai(9Pancx؛脟lifPituat1"a0pu1gerHJ؍nkbhA,sk߀{ƮlavxԬi;VׯNw[1HgefulȧЧPhqalway*tuie)YllhpѨcHac:蜐QoQЌ@whisHqexY3aPPxyH______774576ǾǾh2exXIMHr0_<#(2icӾthrAt@0Y9noPyghty,H+ldeceivelfvXlpBtegҿ=nobilycȲbdalt0di(s 0niaMq2ex 81orQneglecRAded sc3–ha myriad-t uѪ6SBrahwy-fn0agheva"r)eЏڝsaw龘蠰sojberagqay0claimzsalvۑoutward=Pm+hxȶooo"XceaXfroain,
Indeed,xaltsouchmoreghlybannerfparturitynoliness,lPhadoyspiuallaimsponoul.ȁrielaborateeonirfouitanting;pracxh+stevȈiouseiebutyzavailJmittle.Ʌet@hi0dawnȆB bacrBoxreXethatogrouюipbenefic(s Dharma,rexɐWWW>"Txreasu yanwoH,
"LXnhykàPsin,𤡠, 'It0`oIe.'"GGGGGG9sponew`y`bl `cd81ségt's edߩߩߩߩߩ">AdalllifsubsѪ9renunciHo諑mbodmY5beauf a߯߯߯߯߯߆w9shI%Jesu,Christ?#integfȏϵ(ublim_idHXrAe@retudewWenjo \followerwhohIunHimIdaho,Xrgottpytru *9 her;*'leaPheop(XlacsupA`phasر3u*radonpB-mtAalvjy "XhcumPimalaw.o 飊unhHQo soraam؀arrloaئ@ eprom:XSabbath,HPsewoulɩdowoitI;8liX(oȽHlnguagЀ(mfo}hole8og00,Icomp)aenioffeUco`Тmp@辨hm!c(morc8ngڪbe-dbcirys.rdaithrflic("`[";Jsabhorу{󛟃PފМmy"Pغpulchres."sh i˵def, "u8;[procئ8ioApmurQxdurinxfYfxitnes!laspȁH"Bx,"sHuqSy @od)1saiXmotill;"8жxyIhibZercazfBZdenci3xѡ2PfooklrcǼǼǼǼǼǦ𯩰!S"une(1ρ`ScribyQxȗkdн3yFX san fyʥ8addݏIakꁢi(pAohipassb¾lteachɽY}Azbghy.lifBỈs1pngAerfRIvirtu˟`taIx[is__]9__cepexChhxt3pȟC.nQKfaھ8aci,iet؀m.ӴaweM8nimostoyallyollowedo-day,hereoeinderfectensefumanelations:supremesiafterthical%x.

FurmorebtworeaoulsȆcumwith broa`universcharity.ԄPXnvironmentashapsostxenerb@volenc8haworldu0pnhow.ndiahldyownʆBprcastey0m[itsultiplyingamifRZn, now,har 8sympaes9PayonlasgainnoJcvat`pridfdtu8distr`hW)Sakya͍0upoch,hawjrib(isp ddqIrootikeanytre0nlHbsorblif thou(Apeoplehtpellhimnd,dhi(ynt9cIؙ gxattackit.ȃ ro0iSthyGlovqrespoppdoor faїhAnqImxxvehnthoppos`eyffPyAQexceptu(qac*enjoiB[350]XЫhzBudd`m *lthQM``aFɟ v,egraPinarkqsbep8fA*HaHwPhmb8whHalm*!azfeltno X9bf8 8pLshipx(bqpPngAEXtInxءpIigioueIrb1Вɩoutba)frahxanti- a"each0.PRaRmtఄھZahooincorp1ynhoar(rx">X,esPNazlHAhI``;hbjmo[,i9)"HencstlQfro(Znj8 Ziح7751779inferiorЉaphysichh`QmpLpollu)rќ2y}stranger)otweŽJishcoؾw(yXur g)QuiSahaɛiXabj 0ritzRťtcpgmeI܉b0ager`es`QwotKetChr xIesal(ppرPilahbгemxdпӞ+rhuskown'hmPfo.binitesup"hi!fochcexyqiubl`ЫrHH;arAxxҸ؇pItȻ8H AYiIircdisBwtp-b*JZ8t*ۖKsubgh7hyGo0ȟurenovQ0joV0x[h_Awhi(Qkay2ӕsaiA|,abjudgX xRIptreȠ, "Comy@ẩasmuc(hXGGG2GGd)lovX!؇Reكbrethreneaveonetntoe,nteritheoyfourord."hougheasornew,openedideportals!Hiseligiond(vithallnAYcondit(s. "ComeQthatrearybheavyaden8I gi@st腰s0 followersils disciplezbringtrunadAmethodproceduhe@reachirstYXamoa eo nraduyis8Shigh ,qilAtakpossessɎhwhoI.unHrsalQrtlotook'oci`strata؎ask 9sldȎ`PHimpurЌincexa@ngy@ h.

IIITP0s"TsiPdiffXatsepa0ehxCBuddhaGGGggg`uar kswo@e(le؝Jt1sbyCarevesaQrait3p">Bu2lsსpfundnPci@Ȥ81rjmu0 ym#BwmopnXȑuri$us9iheI[353](1)Ʃ۰rooliattituowarDiv@e.hspremntaod-xichhzmo@manif1HGautamahagnicism.n`r asPspeakɸ񹨪(mhPFaPr1enw*tiprearfuHRetyѾMmenjoXPHPX!y iaX@9upPqdailydec2{didot!oult. ce)g`; urPen 0remembXCڵcor!=Toq.̯Kids, "Mypdib(onisk." "deȼXdoadtslorifipSonI܆goüBexouImBme?Oh,e4,綸Xknown e,I."GGE4GGIex8ssH,s¾drawɑq1eng5,meЙequeAde`dayI(ar@ISany~ityؖxrub@a0Xaodsoularmoz/">Howff{Ri!͇ispokؼhhQ.8bCciex򺁇.eev hHyposoph(Aځ rHg,a_ZȬгYdoubtlrЦx(di#ime;maʯ(h2eako`8gainYpspir@sdolym.oP' deep/ЁBrahyhaflowtsankӀcٔHi8Panhchpa `rІt oɇhop̳sf%y8銚߾lO b0dÄRSyabschoo !,TIȾXAgasdverancesndisstablishedeligion,fuchtallyane8lled,re[355] A0hr,hdbee @i Њ`mat0;ZglotPhQaHiusH8ador񖝠fupPIkneupxYeyHXfilixrrAr, "OurƐP8ar";."hiɅIrtaJollownꖱ<0peed蘪;Hbdecl`hښDretuly6emptmocJecȫ(helAil humgggggg>(2)or`d ffDAa9#eirp±(ۤ.esPm9Q]賊ڣmadN!Himax҅bZulPccortк Ilef@l@Peer.)mXظnarebag8@MakhSavМHadeP٤Jexrܙ,Ibe.ȉȍ8J infinip8opdes X|ba96ssPhepd aroepg5(,giv*{!{̻digson`p_\viewyYmsܠssein؇opA`9w+park.˼ tCy򲨙hnewTIؒ&low0spi;Rpibxx2M`g(Thus, @̛ is{IЩgge7ggo`micʝ󰘞zڠ鑛rc$[ f XpwoKs0h. "\8)S,'ؾld0Ye`ё,f1abe'rOɯ>HowtjGautamaishi ?Ʀ,ocu"8ɕeatiny*kcapt8s9earqu xM(ق"ompass@httЮȨcircumXAd p(c9unknharbaHpeacny+bo(aScr redutsi jIw0`sYȰitʻueakabbursuch?//////>"Buddh;vό̳@QXpmeȽȤuyaɐԷatmosrSE*DaR5Inno,i|TX༐sج0crib#xl;Xds: "AbȰayho Q."_["1em">
Iareothohean ye,umblyin[358]Ofpur Xc8wtwozlicgewfк ptaBsW9gIL k.oJesu`QkeyV(!graPtxm"wGautama9KaPaxchso xuXshHIndiacruniitsosophyZ">Chritaj: fǹiservievsu0s empa ȿHȺH 609 Ьinspir٪s⿩`'sk xeftutaarp3opLan.ȶ`who ch`salvaBladis;al`g8rټzp]hBwi,oweЬoȘabhГKpurposmO77777">B|adoptldocti>IB,ғystemdop despond gl+8dPnojruڗg`*PegfruذQowon㭯χ1rel@lQ`klXOnlets H00ItPineتÀinɧful˧xr!.𙺞#yi";awPfromYr(Dhelp#ԘrodWbe riڋxlm1udAdyaisyphePHhopjas ip7 tself.B δSoulEbelxjqdoldrm꿈xbeginnh,fontize="-1">[361]gnoredheeryxistencefod,nuseniXhimselfleastopzexternalidnPswnmancipation;helap,ruel,elentless Karmaecamerall-c@rolling:uni(slaw life.

Tohriaamohymo؆heticords pokenrIosebyuddhaobelovcousxIdisPlrewear"O!nan,...yourney HdrawAitsl.aveach8 yxsӇIian-outar)nnlyi(mucheadoal,xyodyׁXkeptoBdifficultynutuH0yyvesZht,refuge;eekorLootaany`K."OOOOOO>A:Pwhihf(naPy,`sguXseparatpmiripdequacrw{presuYssfyawbeЙJesHiPovai9HenstPpromulgdZemphaw0flitG*Ȧa0through@hth؉ nXmҍ8Ri!ducxؒTcorpond^charIndesngНfirimITbiȜȫDZ@u0penqԹerl">XfelߢZؗdymin˾ɗde@ menоϙӣ(lv{.woffeYqab8Px𥉝/8pho8eKbliss.hyraRzl)fq: IQrI B!ow#H0gra6_XHsomb8ruix§? "Marvej,"saye"ҸɥiI dhhvq˧qAth;ihdgoFu8c;eviyudght."zXhcribɯmN%fתת3תְȯe$sHg0wa mpunish,he_Moreon"di ፒmak]braham!kԣُTinBetweP@youɵ *grufixRy"󹒸p(mX/tr83usXTais,claim<4s؅X뤇B{imH[urgpq#su( Xٲ ӥT!nXr8cs ,y`eachc,GʘUGwar??????8TBuddha,!8x𴩦p ,!on(artxHοm#H idkqKapepxhipchoojaltog` tTtcha*relifoundۧ{difپX's,Zbas؁ũ)ivoczɗI2natural,Y(IRi2:adoptdZoct(r empsyX؅Rtransmigration,ndhatehouldddreemphasis[364] ItsueGautamaave(domedeacorre(influencedisciplincharXHearthlyxisce;uHHauiessump*in#unexinexuteliblyzsimprov`bHmultitudinous cesreincarnZ.Xy@Iail!se @eas؏xp!su䌨lopm.hilosopalmora,id'tredoctr0߄܍roو1hqutie;jitH@notseswd,mePd0ut3e`powpKarma1{"(ursuEthrough)bicompІrXalconҠreflHriqn2npia82ǝ rend񚘄hopALf@no n(bHy)!nIwiaȤ.Pknow*Mrs.esahwhؙm jwj5șaI5⓰:mAbelisatJުxxIbgHnishȫxh髐bsoluy_YledgxWfu@@L'0My0@8Ўtho(P cipodo8odoxinduز3hpXspiral"Buddha ظAʪap`ombodW񮒧BercxI?nrahmacprmigzo :clȼ^٢Xthlfdf8pYn!܋oXni jeP59, ca?ppYkthKbecaJne:oa`@ɃCLRmy𺏫erinvol.ȥc(sub8t“I8DŽ?PholdsuadifficulBĚAH`[fhHKiwisdn.gge6gf>Al8bmembڴ sooxeppws7 an!evad y qqsym{"X; rejHogeWWWWWW>Ihow0wXmpг@vౙnl qhhuȺoعi5alvaatu1cluxhtIlif(suGod+e(<|2umȩ qbeh`awayod(hiК8\QqX$5workdЃӮmCWChriXanitylaimsootsorkorheoul,0arsettlingRdenysoncerned,n[367] Apwaw!mbiʠpo8ou!JesPGautama?8belQCvename?ecr`ی:hПwhapswHquThu K-,ReXasQe0p'ϑ䂚[S辀%źrEceة@illu9/////+Letzbeiszstoo(necFks(`xɪämselqsaid, "pe@ыonhnHtrue!whomou X."ӞƂiȿȨ2athhhP(jitBm0larXparthrw1eriǿǿǿǿǿǵ timت!tyfCÅ8Indiaٷꖕue"׹ߢo׭׭9׭ד. Brahmanana uXonumʥoQ2my(mqlChipiZsazqcIbeѯncin@|radipQ+Ephum0*LcуҿPutd:H8s98 ; Zdeave@/rxmourn0hѸ8׃minZh)hung8feousnЄf(wmerci74obQy.Hir' AeacksX)E RcuYO'(k@eHK0)refgr=Heexincule!noneronlightenment.

Thusnotheave,fotontrast,`differutlook,hichszonlympressedhetudwiaensef`vergence;ut`a(risoreIortantitgndevoteesiHtwo[370]Bu 718J sequiЉzalxHirYcep wlifend oBmltimatattaunto.Ԏfinalum tJmehuloesnod-likenHallp"EterL."obrowperfec%thoph)ituharaci8cBador:imself;i2ahum0willoubdu0dir@il run(lyDivine"BouИtloh psnbhorcgdes,thrinde@erhiz.ea, osכܓciobl(efelicity-o@mdwezor،9purp.yegJtosxh+baskAkshH8PHŸfavourwfulibl᧛ChٟbefҌ9o Śx3pla qKch//////">OCernd,irvanaUworsolȭȮ=we*mBuddha'ȣ*.tmy&qiscuhrigA11aladdX;`t+ chieveIower%+quilibrium{Ш9pvaddq.pl knowǨ,m(ntlyS({ha`yz{bodalfousR:(Ӷҧhty;祙,ryfromirh,return)oxlҰdi5semi-gYneXi,moi,rol 8waGɇ#onneg~ra*urbulsurgtsqWШQ) n-gacla@ry n@,neޠ??????">K`nop( heer.in䁁ȩokҴ9hliunHrsrrat?ɫxMbeth[oong,(aEsu)j(ilure?ͨتXesc)8`PE 7ipmy!?______>Iy3C su݃ȱi"fȾjaQifiIgl؀Ydbe!fҬ2aȼ FFaR)adoprjo98Ώ Toܩɾsamϻxn=‹ڿHarkؿobl))robbyVbtikgo.RimnjGGGGGGabvhsf)C`uldYyJǮbecauณirsiuupීvkAdȟfuim1LpaX@joinbGeorgelio(аnXѵz:!"O!yɃ*Rchople
Ineedsfaringectitude,ncorn
Buthrav saProp8耐oft`urposis,vee nsciosession!abundantkour8vЂъgrow)knowled ȋbolHoohich thlyhasoneoXrs. 8lixpmhjoy;⇨invoa[373]<؎wwwwIs8i`p8Acsay:σ>"Beloved, prКSGod. @`9Hshbe*wh8appbeX,Jnse 0is0ϙ="2CHAPTERIIIMODERNELIGIOUSOVEMENTWWWmatЬfa,ndiaalwaysppultra-ervatH)1Xhny0y,braAQH8ué1yY morigiduar@raBrah@ic;Vd"ppneX(ppm0tsO offereors!remun0lgt. qu,zK̲Xit!ryrgRspecuaXQphiloso8cclu11HipodѰfli(doctpeoriRzcbtu(bt0d!X-embracnap8iston!йweٰntigatqxwww">EaOr8al,sms蒰trot0sectar"-ou."u*{domina`՘ igorPfcruel,5inqiBҾworldٸ@齉ȡfr@ inkdeeniQpushIw)irdeimePd໱sd1puresPej+rowpmarkab`Depwcb2uno!ha8 w9amym˓gx/`b`tlhgБ`onneBuddPmod`arniso m(Iaa𢈬!usefulYZ0woillenniumOll cXdt@@IsuffiXash,Xeart*8 (imp`0u(Ggren. xchi 10l)ȡqbirٮ o{amo!peopleLikʁtImpȻ@X@)w¹+(1HHfac0pl<9?)0楈lyielm(bsorptiH.xeЦۨ< Џlep؉‰Ybeca$vit tengapHptHb`he__]6__riv轂ambadopsۭшnc#Vnu.ȻYYjanoȁmismagʹ di uy躯aem"lign="justify">Theell-knownassionfinduismorbsorbingfaithsXatomentoPntactt,ndzmaudlinendency9peopleaIndia yieloressure+oacrificllehalfIpeace,ase8gravmanyobPavou؀nmedttemptneweiousifkpower.

IVis@dadvaRaujhwas[377]unknABrhVi85seekrIpoPeitڼ`ee[d@nd̵Qcrts.

TheresuchfhhthouXndentim( llnarticulatemongepperlasses;utanifestlyrowiwithincreaseeeareicove,ss@xafta sonalod,itoeracedefiniteaApwern8especialdirecnfluencChr!ty. 8noesruoshibymeanmiabPdispdPwardureiond72irs0ouxprВimpetuh Bteach*atXble ȔIndia,amohanoy,(oail0fromJBrahc(oc0yBengal.epbo(1774fohqbir Americepe("studiweanci9writ0sqHinduismrommoorta0inEnglishjalsopeager`JnthusiaY{Hcriptu;rpur١pd@imselflia8Greek"Hebrewangus.ӓqij@NTParbHcepgpqwro pubyen[380]Beunw() ab!alonYۡcr+convicts,ُ90815,J"Atmabh," "Soultyȳ!ow@8sodlopm8hux,/uidifi`cIy3orshQqHeeȶWpopprdoԞh??????ru*e蹰@oH(aEur miarX|qu0li‹f ` :Spibrg! , yera,hcj岋oragpeopGGGGGG>Bupdurais̾!0sickenbJ33;ϸweabwaQay0PriьleH s1Xɳ>I243SoXmaj"u anor agXzed1bs0,eb(raaTag.ՕgHdyΤ#׆ЌpX(nQifӏrgy.ǃ¢a" courouyopQȰsMfظ1iiȿ$hlҦAyw1Xhp`luSɤsrega Ved(ZfLowQjwxsruJm㶨z9kmzs0ry󿰸Hboນr`Y`oPyǷ">]membX5spXaggu3 +ngReasAlab`(ltim7Üa p/"a(aŽYpP Trapidmeab(0dicatwchief`owingJ0XyouthhoHlliKsupportDebendraaiсgraduyok2re hisnndpmKeshubhunenoadfigurcertainّAstrikj`ipc Ia.ȏcquzgrinfluenav߇ڕontroitӀinupuHlBdeȖbPx|Pism㐿>KaX HiasXfullyellectPHsourcaldeeplity"nri(s;bmr aoghmytyplikdev,lRigXssceġ(nout eyiel9finaad~Yogi">tles(oulasouch[383]¶ ,""pglۀpp"rhmىorganiz p8yR"happe6ytdIctty89A:r{i0isiacpliz lmadvټ//////+Kowi,#proʺ˺embodi%!Br'1">Bse@rIHsyxYMvirtuesHurȤnexaltp(rEbri8aضoqiɼnpa`leaXbecz5a^d(hegge4gghnYabɮP6irbchark{ʻYfoll ԻworispulawHdp 8eurawygar8.!noHubCoi0selp dcthpGoz䈀ld׾׾׾׾׾">U influڢconviHrub(boXmcho cIit)wephXica4mh\;stlnl1koXǮǮǮǮǮ>FQl@extrRradxso,pripf`h9grp@ssccarhanopfoh5mA7n'u9x#yga8ajaooBeȋI76.gd`koY%e ~ fmX< wxdhouphbourte9}gro` z.ets)QM`Iis law,hichasassedhieflyhroughiswnnergy.otwithstanding@eacta)eeaderlaimdivineuidancenaffair, ifol
[385] Thoo(recion,!May, 1878!erebjorityfsocietieӊhirembbrokewayromZSenPrQe8blishSdhrnao`"T UnivHal." "ssm aeble⊰Mr.;yetteQhimtrammelPdissatisfiiaAHpon1,gavetmoremnant pportun鎰launout 0newojects{introdumanyigiousagar(momphk(,hhoc.A ban"NpDispen "(8i!aditucultivap@queЈpiSseeb؛(osmitKalracker@hsomejsacrintu9Hfhri(aBqHnsߙߙߙߙߙߙٗcט(cvX0did aXits`umlai.tcidiГ eatfeshubu kbeginnI1884xImi`ɦ訍spiXhillbodeґsotspnȪulducceop炳Phr!gge6gf>W!HrtaRu8orHaP`Bo@Hthalhs 0kna4torZIha.ȏcaPOIQonie@ inca§acc88:NmaspHXȦylg828yˏulpbelȼ08s______">H`urؔssزBaburotapMozumda`tgaISapos3de9ХPfLmyoyh҈8qk Pas1Џ` dvance.³؃obdHtespHinevx8th߸`pasankMaؕμw1lxmRala@הWdeit">M=!,Iuall@qinferi(`Ϙmselfخ)popdeep tͪT|aafulnglistyle (bXPwؽѩ:er)cohت;:cauP|publicse@cмAmchs@W(hochar9mIaudie yZ`cğ@qu''$7''''&h2cer">III Numerically,herogressfBrahmoomajaseenostisappointing.t lacensusre)only 4050embersnd,?This,owever,yoansepenttrthMmovem;ortsaiwi0truthatanyhootgisX mselvess[388]I⇊arocrcharacA#largHilitagain9popu.ɚ@ealmX8joEnglisAx8 hsȕ؛piultitude;rj8adePtprecimpaȞHwell-beaxiYeavouHoxa(br;&etA) Ϭmrh3nndispi.ԭehaveܫPicنYe(G1bBwquntak.nowamohRoyce0ewڼOIXHudy!S0ptujgydcs񋳸ؼps.??<90?>ϳϳϳϳϳ>Chzӽfo؈XaallBi;ҳI*Cpȗ7'spoSͨ`us0>sollHiofu8ak(HxngX_!wpwipn!ge bfis Pap zum,loHbelper𑩠Iȃ0Goodiday.ȥٌ闊devout:is(8\xdraduate)to9t`Jouŕu3IOUppPRotnwhi(HbetrayjthP-proӷXmemope#!@nMr.nstrl؝"YSuffS"axudPityllrow6occuruhQPysdGIsan ,ikeheserahmos,orurpooftudyingurord's׀8sponatemorablccasiandrك0mselvesus enapportithimhatondea(yerxoom{te?sarted,tasardlyecessaryAanGodQsaywritern`ticXne"O,ir,nwishou[391] "Nphtwysgo,ro1)iycircumstancjquepxonrelashipA#.1sen@grx aepiser` spihrePciliڊ@yspiEpracPI myspious8lfee0affin1S psubjeclif󁞚da`rvell(tfascinbOfdisraghridicuь)@Yrd50der*!onywhichHYhtnbiddenXy3ȡ: mhAEɧimessecrethi-shopCalcutto硑so-callike didotpowc0RinPCwoul {bou8y67 9alP@l].ywialstravaih8lУpcAa@ia0ek-deveorge2d0wsgloohas#surŔbsu)@dyxah0૳nduoвpPTbb:gswam۴Hrsurq:edit\ s,!cuxituHw@YBr)npXehoYzxchildrלtbehex؝\hSջseelPЄq|rXa4qRcl9ؓiepɖlov+IHpiXesPlRsangu, @pxxQsympطso )purcha8eaH}Ifrvi講XK HѯunheȒiderom becIىwxѩY$mpulheqdټht sY*no Wxaaiple;ـnxie if1bзѥha񑡍*1safг0exalelf!HIgnP!tru`u3im8I vlwaybefuBsP9݁bePaidfir nމPȏؾJ*aξsspeп,q*wٚStbխyQHifìIypQ8phi!@ (ؽZifAinprfD3midkcrIsymSerr8uiti|OKolPغ8owXxshmagn(d(Kli0eApdkl.Yflu1wn !أ۪0twyY xIbPuts:f#ianyI*awɮPIIQٕpy."

ChػSAlsb`antXȩૉhim1cern ٖmissd!ss.—ShgaiAsPP;HPaccep`ruOAta(ye@J@ayes:ψψψψψ>"0^MBaptPn\tfheethodists,utChrentyod,tlovendeeknes肁ruthself-sacrifice,homzworldelightsoonour.fou[394]8,Asia's(acome retuȉXus.ԍE`ratefu8Jinghwelsacker|.Žnot;hichuiAAspi.ϋ8rY! harmony."

Iur`rncemɖOri@alxac(ntinues:>"Wa#JesusՐя8?eИYH0Hciplwere- agenciprimloyedʕ2ropagUGospelϓ(chǗwfXdLelopxiS.henɚfl ,yk#bearintensed;Hfe`Himear(@hPepЃUympaes.s *ruxcreadZhgepӟegozkdesp9&urYcenbcommanЩpwIg𓙇r[r ce |ir٥beau膠uean?9mo"5Yipo؋ЬxIPpYiHbYtiqȃ]wpgainWWU5WW 5^8iteach89th`݉cWlfi*u)Y">Ale0KsupposxMSaltogwng!pprech(sAaٻvrioefcyudph.ornAobserv߬ǬǬǬǬǨHu`}lqdam,YІ!.e iworld'Xtonɱwwwwww9;croshfd#½`pY xself-saevSlifakrubfbobed8:زFer,1laiownSs,hld!suZRmȓlqJʰЛoodox`t0iߜƿB(hiavT _ ic]wrothpidʌIpla4h ڿ2lpoexPiypuXsexchmWWWWWBaR, `i@God!ƔJivʼ.ͨe6 followʦ9s!`thrQQiٷI(ejno@n(ym0ctrinXygmpPauI(y, '`Q !'"ϻ)ooccasyOJWibnhw?̌]𻶌ʹdinflu1Qkousou ၾ;yu0krepudQ"namago! Qo`ٿXxsˆߺߺߺߺߺߺOR0smi mbuPrcspiriT0`t@Newisp8cremarkoooooojAॸttf erahmo`(ac񸈐/Эpl(ns1Hindso?s Ч(a82orgPztherahmoomajfndiasramedponnssentiallyhris`nasis.tsissionarytaff!N,einguidQrePbyherinciple'Takeooughtor2morrow.' 郗fice,ttoesreun wshich87.lmostveseholdaictuЉ .ԅonLifJesusnengaliAay!NjaStru(evangelIcalork,i[397] AnorYhes:>"RIpXhave afeet-Gospe0toearexaltt^SermɒM`pBut , thor(!h,oHremainaealHbookme.hopuknowitabaGodi9t0Zrombove?׍׍׍׍׍>"km(ht-bloHmanѣIכؓHdocri٣yifwendڅsishour#sraonqrbw1rpltH@eGGGGGG@FɧXseuot"mb8iindefinxly,xIscharac)O8縓 robb1prJm༨iraypcol,lafdbij:r@gBdLh+c#befmessagR☑`peoVxalimmacul葃nol- ivx-giv#inelӿy aMiminxd¼ yimp$sretϼ">Morelʐs iswsalvRdoubtlrrppheDe˒quiлgPt!@p Communionfrophetsndaints.
It`oteorgotten,ow r,atis؄serveuchreur endat9`ri3. p8apble XeavɆ8pass(tinitedoge,debascreedz@(poБll-embracinguper,Бullisdomjss9rrectisЕK[400]seemscapdoh.

<࡞h2=cer0VJesusܟJ psn`"dulgشлcheapꐻ֒8qLordЩtpudȠJly;:a,0sYxhx!ӌtPXtore(.Ωɿles`doubtul)b9iHp@1Pnih+ɳrynculcלportȎ(s">Whp^6agKْƞXЪ؇ultimZ2øq1875koBombaAዅfi׾Q6opulh0dssٻelmaseeor+riTqRlI ]裘ev8iyq\whictoo1taaNȕ.ikY(howab8galocPHs`a}flu.ϨH)hHrཁmemb߬P`, 70a U8ProcnQdi׻Xjaub">MarecentlyatheredtsecruImainfrom ducat0classes,mongh hig8astesargeprevail;earour-fifthsfAryasreaidoetwice-born,ich遐eryignificantact.oatotHnpopuhar(HandethodasellA}ocialsitionKptr0i0Xemberhrapid1rowQnu,ޅxmajmovemconsiderablemportance.

TPprincipl0X2enuJcreedpnotu8gripniHpower. ymphasizunityqGoHiinfallibil[403]
It1roughHn kmakmctouBresə(њagonism.xkdu# jeas"Unt"C rn2rega@gq8otb(sea0XsahoВ1WHo`ؗ ngsייייייӝw}Řmeng١TGospe f @aGuru˥ qfoXHimala HeIZ9youm8ber?doctȭؖuppliڰɱ`husiasms.ưeologminayhv(lread onrthiodoxtyepiouAcy@oarireac$ԩfHwaexpensetyYo-daNYɠa,emChtiauhsPPڸ it2OjEߟ߷{4]coctorgan@ ltsel((dxАaghyFfgȿoA@_/////(Lerb8h؄wPoaplijrk\qcu8whivre braWcay mق`'urs8A!ZtR;un8thym@al*asHl(ggggggmemItooe`~aulwaagdHkHdolatrHear(marriagepzvig1s(hmoeeduc” aowTvarphilhropituV Theocietyasoundedyussiandventuress,adamelavatsky,nnmericsoldier,olonellcott,hoBteasyool,fotaccomplice,!hisleverBunscrupuliasate''''''">In|rlytory!movem0t鋸headquartpyraa rXaruIx`e9ardindumdupPwithartkȋsances.ԉRaiewnvXingqmj0sta8munxn;Koothoomiڃ(Tibe8hatmєHsepdbe"spelg!`esssimilar form9ave!xuhad2beenHr[406]N9Ћsiabt2llrfaiɦh8exQyi influ IlxZPtrڦulYg(ghrsotzrecMpeopow0gpolrivgx\pdeepirH:hunWWWWWW>S{ Mesx,{\!:]moulĩIerrcӵ8)itQxbH a7iKdlopaPro`Hca(oucl؄biѲ x8c8 mv艈$loqjiPremarkq,ctxvivi`embal9Jwor(Aapidpxi;μnfdolabk lx`ry4harX7mmo؎sHf`as!selfQoprPa,soc8Xрc8iٔsx0Yaint a @xcpom 8gXPwxXwth`a%Eng-agregby!eoddSawHgkla(8 Xne%g33ѾymZ!>I,hba蓺оxpjuA۾p>lpa,remo8_qar`uxn;xpɥ߾;nowhmi1.o اѻп@ochiefhɢ" c7:xagzƩ,Jon .al09!ddixrvi:ܐвjyaphilDPuali9dcif8yyhl`nromǻneZȔ`kPnorap`lpd!8>T ,ubtlgoo@HccHн9pop y.??????>YeHcan9Ploga:vaؽsymdo(beguR*empuph#beHyrumhalr`gܾa0 i0(duc`on;̇Qhtwhy sheasoneouchorestablishmentfollege,ndpracticallyothingodvanceducationalnter(she-neglectedex ndia.

UpondeathYColllcott,PhidaFoundTheosophy,a1907,rs.esabecam(isuccessor.oar ЊInotepcoxrnedȀaegAlus(;iшavowymp yiPHinduismAhmsdai(troplax؏1art//////">PthodhiXe,(verhgg ive铑futur ursmoveggggggWhenx,wr"c(XtyinvokeҖ`sulȚP"Mass"0venigho<,daiew"hoi(YgPoff.anoubtboutprefxI Engwoman.[409]Ifapxlmarkbeginn)nPeraleVh@duKOXwiXbntird8yworkEP `aurd`pieglfiؚ!u airlaunchѢ vih o(!ѥ8yaka)pig yaccumulamyiJpropelBsup8tiIown.Ͱ(any l(,;leXeldmir*dlop"opag¾AHcǺǺǺǺǺǯyӧ)largumborganizZ[meằpXh$ƽx !nC8x@n;societ0-Ytimert(@fpureXsseh10gggggg>OrAox dϚ\oroughsuspicioPt'scª`mpr a`ertD $ȹct0es_PooҟٵP#`l(rHppos҂b˵pHcic!\exb9гrmoPthXdlikccompY-Pgood.ң,rRl9zsPas8it@nwar{. studCa񸨃  y@magn8ssonanH, ii=GreWorldƈbTө!;f%b鹡ig؆IgnX϶Hundntalffȅ,",ۭȽHS2qu2 valu:ssum`*0𽰁ale`xwaysalvWWWWWW">WYfo󌙤~ pȹ$w0wlacitpXgfficacoHtoplimsiblJseXowYhndervi`ǍopӃCɬgge1gfdnȤٹhim0PPIߒ.eaoQruth,R@׶on red*romoݘu7eoQm"lign="justify">Whateverheosophyayendtowardhe0lopmentfnrihaliteratureillXpargelypontsttituderuthPdxi9nenpl,ʄ HinduismjChrianityparticux.Ƀ8bitw,pastoesotncouragen)ℸatereafшyosedxtbeir 0m*`osane.8yeehaÃhnkful(nythingɌaccomplishreservatSanskrznuscripьxGCholesom@yhn p.

π2
[412]CHAPTERIVTHEROGRESSFHRISTIANITYNDIAIćOO>Ftesen Aus71has8uaY@India.yrxurchhfir8gaRconHtsӖPpexpHhc:300,000ouls mIAMalabRoÃXolic`lso,had:sixGasHgg(bvadtuCnowlaim(P1,5followers.nu9, 1906,Protestancelebbinahq{ir%woissQranque,Cor)del`.iexbalg:Plutscho`𫈫Godnaug01orkito-dАYiramificŒү1yƢsX`insלײOheqtroducnew qyfѦXmavsecci0l.ǫ(en,0deewrourӮq;u(jchieimb(baGpcmonm`HXu inߤߤ3ߤ޷,Aptlrn摨k1muZ󘐕, cтfaily)ecmarkqper!succesnndccauseҰooo">GgXry.ȦdXhPelfhQQeople;0udweH;guȊF1o0c(ӺнnacV;AbovelochqnctslIxۄ]Wor0".ΝAШ)BibݾRa(e.fٟry0;ervg{ωsIefڡ1ToȱXitLaOr+prmAiдSou"2mpIq)"subse`ϱsɖ8sua(`Y.Xprac*'s2 impб0lpSKowOJyx vitIiˮ[zQy<qzrevismthYA0Jno!iumphYWQdH0ӱᵚapBon&xhhlookre( bppese4+aldyXQsr(librpb-dld,׼/O8xx]ifoldntworkԶrslicjago37nЮXtxarnPmYeddiew otll-clpeass.esctivelyngagednllepartmentsfhristianffort.rotestantissionlaboratorganizȃRity,ursuingJlinework heevat耉people.tasotnchurchwhich4)varixhmpastl ;Salso`s Pffangelqdibleh0oarry2messylifeo villsnsp+s re >10,000aychools,ithiir 375larbesid3youh񂹎 )307igptuTthousPRPЇaᇲ,many?8,ndergoQefulrӍ8tearCs Ydichost2tpt2ɈplXear;_dustrioh*ell-trahd(eatettleKpo8ophssryotaFbؑ0deaf-mut@hardКncyLcXbr)lt,om,Rkpilؔ1 xlbyo`0%8India.

[415]A֚ә"aSʇZ$>Humb"a)vibrou3SQnow 8@hm#l`)deed,arewPexpecзذm`\aAmun@f mo`pul^3cj4aAh"0bop ½0meemodiscouragAwhضrXPBgi/뻢nty-onffྗsocieؽ2:uppxryIc4(aXxPt11xot8򪮿26׃Y>So hawoul`warrquҒargHulмconvJ砲sleߏ޻ is__]8_^.duct cadnlywxiply X#xcsԙpʋJyapiP(+timful2wAogradu8aeaxletrǺǺǺǺǺǧÖ itself,٦[Xl(ori,mParkab8v# ypenc8Ild`perhapsb-ʥKfee5YBѵYZQbȨs"wip growA`иhma@dulaorganH"NM/S*y,"ddi(byulhip,Ձfẋ e'0wnTI;y spcausp8ous*symptomhczģd,⡩Ĺgnhopeurfu(e">8took;yeaPlࡀKW3z:quiPxple{Xye{ʾptrBguTs9hid@óPropt~nffortsnhisandncourageehristianorkerorрalldirectesults.

Duringlastentury,tetwyXwsaveeenactedithiewobolishcruel(iousites removrevoltjomdisabilities,ucsinduism,romimemmXrial,sstabamopeople.hes1@wejeeXofpposon\?rulersAnd`)Zcas@one,0dserp whi@)tak8s)\cїIndia @strikontrY:*educonmparamodernin:0intust@v8wQbrou`h0ensntporminqbe.הqphilosoph)blhaache;J*choolm`ڛaeiransidealߑoly  ,ecclesiics,by1iryvȜʇ(إ(influmanьmwhoks huniqrepre[420]IPsmpboZo1ii#3colleg`rsqpicuIenhten͐popularjfundaa闲3ϳK7unday9@m!p8fHPsp t(r,WRfyear \r0e`iXwѯ赇re)hfavq髈ZcepcB(ѷBNX̳Y8vigojRȲpaoA.(uryQ"Swade8" (home)sw ydeaffeCjc ryQaEPwڻyJOLgi@჏ps@iٍ)s!regardȇ0yd laH.fyrsŽfiw0uٓIбPQC$忘-wiapplau؎BҎᗨw֩ɻA@qt )quj走uaf(и(܅drqsmQacDsHneXer1 isyagnPnedҶнba(ranity;⚸iℐex+awakePplf-rwnqhlibmoIȿؼ㎣becX㾐eRyiwhfuhх9lxrerԔ|re@*ВhaIelAThtmeanPl`ߪ*ZquieHevolu,th7ocialo@japsƊmuY">N賯orgzsprunexi!Twina؟ؐbmem yBrahmoomajaIQÿfurnishheeYsylum*zaxym-who{ab8dlep0ai`itCArya5ppealga,fg77777>Sڻ` m 7K:f)pɿ]atfb@artden@a3Hi뽁aiҷȫ@!寀ò ,̚Reksubmitsoheseam(ocialyrannieshichominateiswnamily.hatndiaeedy-day,oreannythinglse,s[422]domqieincauhre m.

ItrotestantismhasaidrowmpupمIcal,aKqcclesia(aspectour،8;⑐faኀattributmositsfluenchCdlop8҂Bnlif(Ј">OfurɐqBri hovernIpol`ly3hreprnqprom`隙ideasouldotXwia truhoJprincip(bexpervvmarkP''f`hbh{[ ">PerhapxogtakXissZduZtwЏȀgreؔt@sAaʦmselv9TXH8deulftwiZiegenbalgC x؁rne΢ra g8q-gds2VyNorK)orzeХMer`; dirqceChrianit(Hindu $3UPapartmagin_ salsoremembhȥbodh!hlo`rol`dpazmbputuhsuspicimpellpettyȱ0Lp8oʺ cIrgzowship,ә߮decadRy0.ƶPucojnzbeorڑ Faden!fmerScotlwYfH1rcSou ɵonQbexnڛ`nrxHdmjїNwpSnd.zksJsul`ѐ i.כK,ow)٪ȽfXȝ@regard,ymp4xf:ry`dsad xines}Tgn!w⼐sA䞜KdhGo^IdvaDxvail:Eng ̥w1lE@Xop,wayWȾ">8"facȺPapQlookɇ{eedy'izAyeanx,ɣpgno B}rep4eaؐ'ᔺؾBhбؔtot8nim袂kstimsZthree-hund8ҔEopuon!׭׭׭׭׭>IŠ(p0ϧjjtQnu;lowth-haoo mfe hfigu Hfa)hbpQo ts">BZ੬Pto񶰶war٨coroughPdigpeisf(4`rp J)𹨧@,QnJmI0daoIrիkXci*GXxRoI;?caȺfxilKipcjs`بzubtHwisey98Brahismchdi֪nfli؊Jdiffٮ+bephmili1deз"philosoph(YYpr`iX8igiPѿPɢnerxfeopltheightyyrannyfaste,heebasingitualHinduismndts"uch1idolatry,all seonstteesipfortpsho0overthroweems butmpossible.

[425]II0em;4AauaiapartromoutwardS.XEsudwaken̛ldre@gd,f\selves Yat">wXerntypﭸVsurvi"f0vAamodH2ZfsuppbJbe`Z*Occ@docnspects''%6'&יgɲceȏxϤh2st point7Ȓ9mo(Xev,𸀪npج eleru8("ѧ1rhxdmix2e)-ɨaewpe`appedtivʽȱ*xhJhe(`e1hit y00y1, įIiAflu޵ٯ ncreap@XivqimРp(to.͖erchangTkh8݆uAm c`yOsh hAؘ. HؽpCZfunda9P+,pPmo: ׾ۥkexpuμj.ӫ񱣮ؼxcrepnglIrxongrpexsAweaxiputynlQ,{q-eeopabPHPcIyrضwȏxbtu0X, a?sh;лLca@tsoonxl mEaI-a@gul mj๡asso7ci geɂharһ`nri`@iDϻfS#ꦹbby廠I depm@-upulispirituȲ[72KulbHPfurhson8Ih߇߂ٻÉڹH5 Abroɕ,r( 0gens

<Юi="1em/h>

NPd(۷_Wo9vaasaPcclesi(icPumclaiopo辧ыDѠobilshb2azmoWaŸqalf-propag#hs٤zaorgz0Xtu(Hɳo-ェchutp0нmvʼ!porU viaglifqionvcrxQoverleaptcclesiasticounds.tspiritshflowing,nivXtreamstohefefpousandrganizationshichreltrui9philanthropic,utsidemix_icalhr tyilleo1India,ugt:world.eG[428] HowePmay,Ŏ`󋑈incXslaimsJaesnowRr decfoiemselvemt芼typp0ux8yKchoo(cultivatirwn߈߈߈߈߈">IoPayf rstha;prX 퀐ire@discardePB˅̓modifiedupplemp D=ang yoooooo>whyxouly fraithpfwexOri@d3becom`raciwx y?ԟgrpposiamo educd ͌71timplXagonism0elf,➡westernarbæN1uq satt().oncili¥adp{hbecha見reWٓ.xdidmif(nc l4ssubmissivhaSwdpmhA-asser!lo-dwhwramPЯ"aew:(XspuratHtgloi yв(OOM9OOannoybP̦m`1mll-import">ѢXhbarXZdhpcxXlargJ, в',󞚾hibboleth`ronxctuesAכfup baԛ˻speak{Pguag)eo@amlini1li0bxlr޾so@lojys٧tز8hum˾domGoseek pz`moB denoPm Ocau؀IAHeaveб 9le3 1diPrmp8iK׏my'Hu*ls XiciPIY`n؄0twxgz˷Pdeep-workuci>mxgivbiѼPigsٺ@&hasylu⾙lX:[lowكx"accxP.30GGGGGG>I¾1 ۈE/erJ3shoulon(fbtaldirt:`help]dXrcumg٪aźɣRap0okoQd1ckriHz/(ªvai˶J@A˒: Christian,sanctromindu,riplesrelreadyakingonderful耸waynheountry.anyewȃPtutionsaveeenrganizedland,hosetof Åndot@u.voldestȄyzbecomIaffect0byioppearoH@which (ll0eahanmbiсioduce[431] [Swami𞰟_Hchool)ؕapyHkfrrdKtmospherЕzsimunc@ciH@adop niew2,tubphaApopul0exciteAgi8publicqrArecelauȦ xgr<.wx8rVhkanaAbS8AAr8ea R?Ʉ2certainH)8or9ox,ra ϭEast.؎0؜ngYmp٬otyig𜒯h oWperhapHmop!picu2.פ PPymzeni2ЌaIMadrasww9jnỰõ8name.IknoubIJle mil0ihphceXfpȹ0 idehacticˠVQt=Ƕa.r@r¿ hl8"+RtruXsishi{(ӼMIs0ompha)|sencs@ppxةUsPX2wordGlourlamx`r!ovر@o;Z>`ene1walook"tWepcipЅjߢp9Ⱥo-dalpX00xgulftwɽIbulU, ˀ8exqr"ictoo%q(#?@hnhm<2">Oif8xaqmhiply itu3qireh߲peopPc`1seSȞnon-|if3tifmot(h!SomajܛӤmmeXmEifO4pJ(l!(eav fЇ޸ xz}oftxWWInyiohreXm>⦈3rge8pirebellagȯolms">WqksmpopW¾So҇jfcomptAdomi0ȶPsharp B,Bualۄ'Vdotexa`tse(littfPpossib0hodoxinduism,ndetonstantlytagonizingtseepestrincipleseatnto:veryitals.

Thewoorc`which,ext XdirecthrianfHt,oo8promulg0onfOs`isHprЁublicchoolsgo nmentelf. aeduc2alystemowevails[Ãgrowower,dnc*oter߇ithouŒ.etenallsegods;uteAm؍cirorkayergene!ve Ё@teachturnszm9youaway[434]2.#XIlac(WdehLacque@creasat8(q]inpo)sXcarnatihwn.o񓝀pыmo$nosagebe+follٞ򵗮beby\deviHuPanqous!ooutwamembԙfaitHCod`mebazږity,esus #Heeh"rmortyp򪀬5fex()il(anH ʻy䷸HyKxhnaimhHw80im(-Ram^extPrv(l@dlimivirtu0YudM"D,"//ne0ssdBYjyeȚDZ#`a!0Y,Sculseri!;amb20afXghsh9*(곣mma 0aجBormy5lege 8a(w#to-dw"SzispQZflueNstudyz8ղ XP`qGospearûĠsu(bookgRshomh˼`is's "IH."H)ast-nam wnsa- tlePfriiwer3publlirmɪh!ɱhkncy`шmsЫqiriɵ>;!PiV0epQnsзshJ,ҽ??????">Ask blٸZwll׫׫6׫ou+̿XE,krmselXHȜmappذiqu WWWWWW">I,nط.tartzconvicҼunmixevilsľenryTemS(bwo)\goisuէ.oPpc(quAаi߷beginAfehi[/ï ҊW!him73fheowerassionssithiewo*culturefhigher.Ԃmansinustie,atGodHyivendrospYChriideal,spposed5Brahxic. eave tJم1lifeaspreadinglvXIndia*ransformyaspiratbpmillbnoXmonoromXt[su cehichbe0mdYanmo4clezri؊Holessegrexm.

A5entlehak`sumpsmrecqyԋA(fel-sHindupablonderstbettHʋ(TWest.ȓlsoimyulddeepgnific⃌[437]3.Xb`أSIncarm,yi8uniqueBsu8"ruB]0@ rapidinc(peop">{"myrih#c1ruSee \s yburddithexc@eag 8!%oximagBgivHim xhexeno/BismLbeen0r]s a huc abdum">\to-dwglaqacceptUȤaVishnu@ni iiSmi0٥0o0nXobpmearesȵns;faiarbgradu@Pt*Bhisg'strP^ow!/.̈́yplhn𠿒onЯ"輸ded"J)spi@ɆI𹐣r@cezreҮnُIanquhstyp@tesгloI,ts" s sfyѸYksxayJ5bdaȶwhXajfἸ-K[cQ}KrferlϮbeȲ!al`AFaYbolovzHmeX 1n8itassrieekVnȺdh,m9n.h@angeRcraroblxlf8Xdiffѳxhuh躈chaА8!I4do0C Hr ,si,ohoaga)hchild.)Hsupm9hosulJdrder; aRعXAilluminedndransfusxbyisove.asheternalpirite 0strivingn*heartsfeormqHimself.h0incationhichgaineverreasApow)whoseorshippdfromapeomoxhalayas.

4qerosChristilleccept8IndiahXeHexXssGod'man">It2ruxhat,mop1nduo-daysiGreekJewold,JWShafencumbl-blockideaviioatonePtunsoun0 lX-cheh@docpneKarma3p(iblsunisȐval*7i>\2g/fsamne-s@pec8t8obt7{iW,w`eyelˊusn@, P-wardffici(1beconArably`iXa0byyem Ito[440]ee< weޤxn:Ýnsmigrj,ieKr¨//h;sugbirHknonogͼbؾ0)ځ򺀳٫rePȃWa3t@gnoX[I\hѭzPan؎s .wwu1wv>5xli@ cep=輙i9wacQultimxؽilةזזזזז">pϾ̿ainx;'Msh ggaplX۳cal.oPemalQ1r  8ndxlargsng-cish`iyOKFmplicity X1iequ¡.rradu emascup4纈ulwoȣhtifde9ssmeXonailthГQPauh*certр@eiunclH 1peoԽd+wx1oooooohnatpur)circumoe+M`a haveبࣚѤlbliquqה־HԂJoA0xnd(0)mHly)QxrixfȽKsur0gO‰douБ`parromtruihouxhxpla mpo` oX”(Xҳoooooo">Butabbett ngsdawX˱gg1">[442]hethicalonceptndmorsigniffifereeginningoripndiaeryoroughly.IxlieveatdayiloonmehennceasoPnectedthntelludelusi ɅpH,BalsoceremoniHirregularity;B8recoxz@0itsruUhideousness(񈠆9not)0?deepestpuerili.

Thus,3),ChriemphasiserncivilizatupXÌtyb0hchara`r,9P(growY ixq\ri0lour*perspive.RgradtraiҔQpeopBishaw{ecɗRW`34ceaߌKdomyGo(sromulgabeiana18long,rusolanc `aclaimV@kanaYaiqonly 2mwPcapabQȈ(h@ard!himself˜ner!t2makXtmpossiforurdrXoxcuheqvePPonp8ent!knowledgasiiexecu,sayZ(ah@bgXpPslewsan!ϚϚϚϚϚ>real8pa0Rquie,`r0lp)mQyfrevolu.0sumal<<9ze="-1"3''princibRrpretqrapid)8s.os{)y)hse&w mp`i[3rf PJesY:lab!fIGo l(ps:wȨ;mag Ved9;ubsequ indu`atu#AdarkBfeeѦplfes1؇񑿝(b ya`HhZhaZ{sm(rdunrsLfacceptѺًyporlBre)Qwpp1"Swsnf "AdjZHob3*Px,zs alt`hensPlatwiy*c(@otPa0rts;J Io(,0Iʜitory@ز*(nabiԮIsݘ¾ýnflغc8Ģ`׿؈8pil!c`qipSzmuossu"NJwhwdep;zHhzit."ϰϰϱ="2
h2erxNDEXAbhedhnawami, 431a>ulazl43634431a0934862>ׄF202ׄC08׆׉kb:eǘ؉966350߈ߋoߋoo9arho(gЎ/6476///lahՕXaS4782T9ymsgivᾨIslaX+5490+24Qtruismyz`264922183hmsaЙ1082616rĶ ricWN7؂Ǜߍ5ߛߞnimism, 210. <(Arjunandisision23279154>ׄ33313ׁׄ61ׄׄnold,irdwi09940549yansCasteWT14360WR9gOofhełЊiWest70053omaj 557761r00-40G/)sceticiayH4750737O73046565221628iaMorFaiths47h234oka'sillar]04357ytrge65448g735g7gy׉22x9thi/7)338477;87maoctrin186ߤ ?߂Sabh oc2964go<ںBataraptiqAmericHO37OOI8_GbrberPWifMiIO38272?OgrowDr...o8699oo26ww eatitudeȽo1494o6wef(tingׅWWׅW߼߅Qnar9O#118OK6ǿOsgal,arion04Qooees astV108?WT4ojsanMrs660''#40W70`Whagavadit720615粯7325W߲8焗 ktiW634WWw?2619?uǽWltskyadam玷457罏Wohre`51348oϽmbaXK8935okOycotPߛߛϮrahm9398t'ǂvnanWWWWWWWoomaj߭296O߸D80-40 uddhǾ207727u"SaiJosaphat,"47565G4Gism.6*7msolatedlepos=0522652 >375. <(Burma'sroduce, <چCalcuttaniversity4046h7716''stendommer??97875134ׂntact6455809dnter-dining1807marriag59딧itsesults׋12272חohTotemism7/_k1o_?8Occupatio皆4932?:987>gf86192Decaden209351סו4טPenaltie727פ5nSyם6153/;6849 2ר7399471-151׋5598OěG8454ע9ץunknownn Z123?Ǭkϱaensu-43968/+1/vn Z/639/癫߰haitanyg0wgdgkkerb(йfessor\36606G_S5_rerizf¢0gOgildͭw_0РG_ 羧36733Ͼ6nesGG70095׿/S?ristBBuddhg7409738-37WIdeal/,60275߿/*434-43_OIncarn/x!6//˼707۫f,herosf9 8<]iaollegegaz`[446].SWEffort (ohammedan'6743'GanityϾ1636ϾϾ̱Ͼφ7itsQgrX)Indi/7416/g 12-44翇2undereKeshub32?8ivill,er垱7׺leanlindO770ǿׂotg,ý851gd8on:,γOg48927ǽtradic*BhpvadǼwuw8oche0,(ijahfp׾d7)heory213gOupaArrangemenКom?G?@font>. <(Cyclesfinduime, 286<ڄDalhousiLordǃ29749ǃǃ10džncingirlsol160437ooi10oa>WT388WW2W7te'snfernoN1929 0498440ߎߎ357ߑebendra,ath53110281odicationaȐw&4477ws44wWlhiߐu0133ߖ53אo3202608port:WT06554WWLO/qtachmentߚ5907'ߗs79ߠvilorshipgxharm8(54סowryndarriagǝv6733ǥ6ravidiansCast>5355<GG08488ǫLjԫurgaije^4249W_15_?tchonques7O804yan SaraswȳעM57761׳׳40׳׳׷Ecticismw73ww 5wWdu460ςonaBk"Protpǫ76`//Z1/QlioGeorO19׿װ7׊picurHinduǺ57851ǜĩϾǍschatgyhGx3߿GC8W_voluiGG802wt9G{FaDoctrine/E6180/C2GGe(h729606ϳTϿυQiciSe6ȿshncarnǿ`7wǿ2NJrazer,..'=713''ullSirampfyldw290wwwwnerCerem@eg841w rnitȢaaom462O4竗Ganesh741445Cntolor="#0ff">190. <(Hinduism,opular, <ς-219i>"ssheyre,"3430υ243>6296157sotistoriansׄ982382omeifef1734w2-275roscopeWn8715WR61useuildingύϒ/uldiveight="0"Ѐ><ړIbbetson,irenzil,nast=147840?9O)deaDivininGC1539C2GJeligi?135 olatry545776hipped_''_F90626GB09liaW2185ws5wmadud8r._\47010w'"33'moralityO9749K1AncarnatiY3andhrФ3635?WS6w86007w?3?w_180''dia,oHrFaithu0791??77arrawaddyive'57Oslamk0456׻zXĻ+2624߾O2-33o0ts?9775׾LPu鹗904gNUnitaQ73342797RJain_09207_Ͽ4Gǂrpw49WWR''\'sic1W466WRWGesߠ׿[esus`sic54903g{94dPhseev858Ot48w^90w[5'wweqLove07637728/7sCochg88gg‡O_ogendraathhattacpy9252Ͽ˫iXFamilyy 476W46WZK7877oTdugo895176-30 [447]S7aren3268OzlmDoctringw050113wwuravaߢ>2Wߢ;5Iipling,udyarduX7?wnowledg9WayP66׾o8ooriamon96G/ ӪY/533w+ǽi/li> <(Krishna, 1553912967877׃9׃ׅ410683291>.<ڋLalaajpatai 065544R0Owsbolinginduites581481419gegislativeouncilsEnlargemehofwm77157ww8oQngth208. <ځ0Pagoda,heandfa, <1o73l,epinhrPς054618φφ12ǂυndavasGD223279GGz54GOslamicovement'$466205''!33g'cjaubitsifficultyM62904JKismU3192ύ60riahs aHindu'&96hggc9goliaMemberspW47WWRGOsee90714'xritannicF3781ggCgZessimZʛ'$307506''"1'lutscho,ev.ם574167ס׈נolygamyMohammedan49ϤϘ2?ςϣ_8454_9_QrakiߘN0361ߩߠ߂yaitt~79" pIndiW32ǫW1O>7&697o7/7ospey߰=739;tes@tCast0793ײ, BicenarWW'Wg'/Hioorc?o677?l?verbboutoP0߼5''uranWW2607T6O^91x7?/uldiv ght="0"><ھQuiekǨ2922Ǿdz3ǂGw6557w4w{RahualDZ2387ǿ0ilroadoh1߿oobjpu8a4384WJmachr68ǿ/\87?ypGn747'G$ߩDŽoDŽounoo(6o77ongooﳎ2P727//aeligiousheoh?@5?:9577nunciatGGGGveYGn`t6605ishi_^1wwwtle8Sir.,n54930ϼǢQobsYDrW5181W2g_mGieϨ0095?_ggsSadhaomaj36748'dhuvot1o*ivix׹~88׾׹}ׇktirp.038, [448] <(Salvationninduism, <)olor="#ff">184a>.Sarnath|116131y69wwYtiׄ360248ׄׄ255-257yuchyawu47509wwr71w>_23614__2_Achoolsndaste'%1491W'#48''weyagonnjM22615ǎǎ7edi?<0546?<277haheha95142ǓǓ45O43060030saug'795GGs3Giahs590皷2ǚradd^85483//Z73//idhartt47702NJ#4ǂkh[theirai77087762w747821b Christianoncepof6128274?texousG5g4?g:va'sridentu2Wt0leeping `loor762_6ocialeforn74ز҂/49@9_f58`g߶goheory7W784WӴ_ORothsayer7g炗ߴo54ǸWǍuthndiasl519t cs nn80ןunni____orptrwp2499sGwadeshW29_2o_mi,indu_\28_㙧g#ord׿92/-׿yrhurcϏ4884>0622;4G7416ܾ/ul(div Xght="0"><ڽTantraߌ26075ǽzx8in+Ǫ5739ǽLj48empleȤ7989o1oheebaw269w7sisW2681oO7Ovnsfy8om5498׽oWoosophic9etyM6318/K04-4omas6нggҤ__otemqand׽713׽ ǂwSncN9071oDormigrZ7547 6_7vancorthëihari'/_G_70aaja767ǿNjTravelnndia, 31. <(Tribalheoryfaste14639896umphhristianity߅59007߅425anrinciples>7077:30/ulHdiveight="0" ><ڊHUltimatealvation1HinduismOL331886OOI23wW1niversitiesndolhcGV65544WW ?Wradu.46`//)?'sur453h23wwwwVaishnavault?<22887?:158GGedanphilosoph?607ܙ7u=97;79rdadvaith?f24h??:7_G*vekanSwami%869952/a>855Wexrninadeq7`1774'??edicSciencG8272/771herDr.ǚE363wǯůϯψidow :o%pGo$1g7148OW 6״_lliamSironier7057??9ome035箛52rk8Docte}51749z74Yam62967<7??`ogaǾǾϭ4895 ߽Ziegenbalg7416c1wӴR 2emhr/>align="leftt(b/Endrojectuterg'sndiItsife hou,yohn.@nes7***NDFHISROJECTUTENBERGBOOKNDIATSIFETHOUGHT This ldeamed 28117-h.htmr~zipATallssocidsvariouormaw`!fouin:B 3 ?whttp://www.ge.org/2/8/1r/duc8Sankar xwHn,ulietutl,JpOnlDribdaofreadingeamt .pgdp.netϑUpdtionreplacerev"--o@Bre.CtQwromublicomap0tmeaHHtoJ`waռPSt0spyr!!`s4,oFIon(yyou!)andVe_Zwit8permissayroyalties.Speu,*s@thGener T(*Uparttensepply+a醇Аq?<-elrhcĂ4protٞ/,conceptrademark )gxermayHtusifhargyrbeBoounsIXceivf狭IdoRanyXH&Z,mveryasyYPOknearxrPksuchbderivІȖ(r0℃archETheybe modifiedndrintdgivenway--youayo
practicallyNYTHINGithublic@mainBooks.  Redistributionsbsubjectoherademark @ense,specijcommeriBr./Z***TART:ULLICENSE THEPROJECTUTENBERGPLEAREAD SEFOREOUISTRIBRՃWORKTootz`ProGutenberg-tmissofamotingfree7;elronworks,ysor Bis*:(anyrsso`!یphrase "Ԑj"), IagPppʑ`ermsiFuggRL (availableM(fixonlinechttp://g.org/L)+SI1 Generalԅ%U`׌rǍǘŒWS1.A=ByeadC1partˍ ߐ߃oindpthat"have:,nderst,ޞ2acceptHҠlIu(perty3/copyright)+mentIfdoo%abideh/e^musteAdture oۓie엹prosseZÆpaiXfbtHQ`fssgߝǛ?bo03?P˅Preff`hrntitoh0asetY讐(aphE.8BM"pbgeGtnbKusbǤǤa@2peophdoo_TТ!wecmoǮǭ7硈ouzyf w;S1.Clow77l3)ϮϙG/@folHߝ fhelpesery~c*.EԾpw@aryrchiFqa("B"jPGLAFownѷY 6Ac d?_Gp;Near8ividAWpub mUndthv(an7뻘wwwwTloڃ߃,eclaimp,p1, qmplab cʸHivv+bP: KoȪngc0removedEOfursehwisuppʱ//mi"moB''$bӛpsharAia8Egeepnam!歉6YDi[GLGh{sXjitpttach Licens يASg|orsD/!lawԼhla*kalso璐rwCGAPn`¸nsta0te9ngesid! hck؛؃yddi0׻ױ/>beXwnloadr{ߟݙ%any[WWϱwpmaknoBn0sAc@7u Qſ_Unlhax즏orojectutenberg:
*1.E.1.  Theollowingence,ithctiveinkso,rthermmediateaccesull-tmicenseustppearrominly"whenev anyopyfᆗmork (IRonhich1phrax"|"sj *ҁsssocd)zed,isplayYperfor8,iewiedQ`tribd>TheBookIu9nyoneщ0rHto(qndlmre)@onsatsoYouaDit,珉iworre-und!termsяwtNincludedӒtqnBwww.gu.org2I1dividuaOOHelronic#ЖhSf[ubl domain (doestntaqcat)t0is#misshݖ rightol)cHbK(dUniiSt؎(outayfeeXchargesxar쟹02mߘ皗lh ,Z:comply壈ȃNrequiremBparagraphs through7bG=wgrademaYsta_a8E9.OI3ǕǕǭǕǠGGG( r’yonRߩabȋ/,x7"addial3bimPbyϗϣA$wip81L/a@-oooQfo1beginn84DoJu Zdetaعo_o^z}kĻjil:at- #B5LpyJ쇓o/YW˦@ntܬen`Мߜp1aГ)rpо'WJ6ߺnaLPbinary,蚐,rp,xnXpriprр~㻫dѯhyhtexmHowep k/oe7"aoom`@c"PlVanXaSCII"rd=offiXl лqOdTWebX (www.g-.org),n@c,Qexp#8\!aeanb`c a3Эe_i)l芇l(nyڒKWOWYpecifikj7okharg ,iewfa=1C/۪H9Y?8]reasPbl pplic taxes T hdowntradeY, eh88ed8QunSJ߽ܳ8!ArchFoa!.  Royaltyayments
ہ DusteHidithin 60aysollowingachtenhipyouprepare (or Alegallyequiredo%)Ireriodicaxggreturns.'' houldqclearmarkxauandOOs8therojectutenbergiteraryrchiveouniaheJaddrespecifiS4, "InformdboutonsH׍׎ OOOON."2Z-ou@ovideullffHone byuserootAې؇!writ1e-mail)-3,preceip1Xs/gwdoesgree}mJR -tmRLicenseɘt܈Ȕ3r3estrocopXworksossSahysicalediuG_Ldisconu(accYo@r:_W;.wwp,ccordanc@raph 1.F.3,y//+_XxAȢPlace)ayf hߦel0ronis ve)Hort9ꕯrkcompihRfggiibu0?7T1.E.9If4sh!chargh`/':Fgroupɗ (diff0Pqetj 7nt,obtapmissQHobPjM@aelHarownHtWOradeٴUCa=es3/HFr1Uvolunteere@oyeexpe (srablefɯfPdrighqs8on@ransc`ఐ@oapublPdo0ccolyDespɦhCs,'mcBz`whؾY8ayXto,zн"DRs,"D؛*lim᧡jet@ura84hruHaperror1o٭ i(uaCtyfr𘬧IamagxBsTmpriru0co [anُY hr Qp!2LIMITEDARRANTY,ISCLAIMERFAMAGES -xce`A"R񿊾RwR"j_\Ӡ gg''[PPƄ_wȰq/laimliabili$ 8cost$s`lud1legįs5YOUGREEHAT yHAVEOEMEDIHFOREGLIGENCE,TRICTLIABILI)BREACH CONTRACTXCEPTOSEzPROVIDINARxAPH3'' THEUNDATION,DEMARKWNER,ND YBUT@0THISMENTILLT„LOUALQRECT,PUSEQU8I PUNITIORINCNTALEVENFbGYICFPOSSIqSUCHw*&RIGHT1REPLACREFov win 90yfceiviDjӱh8mon(if)paidiXynR1lanSs tZfrommkOhysicalmus)turn1G%T'v`dꂆ1Y9ilieu[bsp;Ifoueceivedheorklectronically,personrntity
providingtozmayhoosegЃ2aecondpportun : nieuf8refund. &nb#copislsoefX,dema8Mwrit)withoutur`ries!fixroblem.Jr1.F.4ExcepXlimit rightIreplacemplseth3naragraph 3a2 ً'AS-IS'ITHOTHERRWARRANTIESFNYIND,XPRESRMPLIEINCLUDINGUT8TIMITEDOonMERCHBILITYYFITNFaPURPOSEgb5-Somtatdootlowisclaimcertahimpdwarra\exclusikatrtypfamages+an Beviol(lawpcaQwshSinterpre makSmaximum/b{*?ÅHmTinval`unenceabil"C)Ivoirina΋ę6NDEMNi-١A innifyPdolFo2jkraYxowner,heoy$Jon3ؓ"frojutenberg-tmcsaccordanc񑿏ĤZvolu@IassocihdmduHmoa8tribu=Kharmless悐Pd,xstHexpenses,`legaleariditбxu#fo1hichrd@cau#occur: (a)Wnjǡ, (b)XDmodif!d)d k׏׹C(cD"CS`2^QmcabAMis%ϓϳ!synonymou}fy꾊ז?sadbȽQsЏecomprsUobsox(iddle-ȗdew߾tHcbesef)h red/onҖ륣eopwalPhlif7/>Vo9fin(ihsuppyܝϊ0鴩y(earer8cؽch'Cgoal4nsurZaggXlqwillʜavailZ r0e 2001̾*iryrXvoasxebXLHQaXutȄGG#Toarn؋82howXl!canelp,`e s 34ִeb( Xhttp://www.pglaf.org_Y3///?ǿInAfi{501(3)@RxanizXerlawtppiJgra`axXt adIrRevenurvicfQ?'sIN fey覘ntnum(Q64-6221541/s ߱pȦcL./fais0ConGg⛏)d9tiqdfuex؞ idyU.S.F򌢉haOOhpcip(of oB 4557elDr.ӸFairbanks,K, 99712., 鳐mployee8sؾped"throughehes?=2809βh 1500׷(,altakeity,T 84116, (801) 596-1887,0൫\@E!xntaliRup٩0Tb1sڌbзp://pglaf.org
*Fordditionalontactnforma:j 3 whe weae`؉pfip" ToENDONATIONS (dem)9_is0http:OO>Whi8"zfromeݫ‡mj㥳gts,qknownorohibbg(spiLwZorBsQ֊ap蟨 ]offexe>In`gr8fuled, עkKҘi˳ct0t:בB0qwd WU.S.aloswampЏأ¡ff>Pl؏HheckrgebpgcurrhoIrОﴷU*o﵀way}ڐonl1payrexsTm,#: INDX TAGX 0IDXTORDTooaas 0123456789abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzfszszymaaaaaaceeeeiiiidnoooooouuuuytaaaaaaceeeeiiiidnoooooouuuuytyLIGTEeEesINDX0(x倀IDXTStartINDXTAGXIDXTINDXIDXTFLISAFCIS <